SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc02_g001140 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc02_g001140
Domain Number 1 Region: 717-910,992-1161
Classification Level Classification E-value
Superfamily L domain-like 4.14e-30
Family Internalin LRR domain 0.036
Further Details:      
 
Domain Number 2 Region: 3-96
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000294
Family B3 DNA binding domain 0.0044
Further Details:      
 
Weak hits

Sequence:  Tc02_g001140
Domain Number - Region: 529-624
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000531
Family Extended AAA-ATPase domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc02_g001140
Sequence length 1226
Comment Putative uncharacterized protein
Sequence
MQLFRKLLQDSDLSETLSFPTESLKAFNLPDGADPSMEFEAEDAMGHPWQFQLTIQPHGP
DRLHPEPTLSSGWFHFVSQKGLRAGDEVAFYKKEDGSRGPPFKIEVQKVNTFSNPDIQPT
VQYIENGKDPNGKQGVASDIQSSEPEPDDRTVTSAVITTSSGKMQSSDSKLPNLRFRQQA
RRKVHCDFFYQNRKKFKQNKEVRKKCKVLSRKKDALLLLLSYPMVMMDKDQSEKWIAESQ
KIMRDVKSNEENLFGEEAEEWQKRLQGLSARVQKQLDVPLTDDVEGVLPGDIVEKLFMSA
EANIGPQLELDRNRNLVSGETSESTVSSTHCEREVTGEQDKTQLMASTSYADQVEEVELI
AHEALPVPEEVFDVAVDFAVRQTLDCIKRGDINRIRITGRNEQRVIEAIKHHQDVAPEFR
YILGFTLPEHQSSAEVHEVIDRQLDLRLSRCSGSINLAPEFKLSDNLQSLGIFLLLEDSY
KKMNFDNLSLPLQINLNDLDNHLHPSVMIFNSKMAADLEIRMEDHLLPWEVFCRNAGEVL
LSPTIRQIAARIVKECRGNLQAILLMARSLKTVTDDVSLWELAVQKLSRQPTSEVEDIDY
VMVNALTFIWERMNNKTRHCIKLCTWYPLGEKIDRASLICHWIQDCLVDTYDEGNDILQS
LVDAFLVDNLPELDCIQLRREIYDVLVKVLIPRMSPVFLMLGSLRLTEPPKDEEWDAKEI
HLMDNELSELPESPKCPSLIALYLQKNLDLMAVPSSFFKHMPNLQILDLSHTSLKSLPES
LSSLVTLRELILKGCELLMELPRYVGELRNLEKLDLDKTEIIDLPAEVGNLSKLKFLRVS
FYGFMNCSKTKLCRDTIIHPGTISKLSELTELNIDVNPDDERWNATVQAVVEEACSLKAL
RQLNLHLPNIQILQKRRAGSTSLVHYPLPRFRFTVGYHKQQVISRVPEEAEAHFKNGEKC
LKFVKGRDIPAEMKMALNHSTAFFLDGHATARSLSDFGLENIKQLKCCLLADCHEIQTII
DCEEAHEEHDSLEKLQYLNVYCMKNLQSIWRRPVRKNCLASLKFLAVHACPKLTTLFLPD
LLANLVLLEELIVEKCPQLTSLVNLTDHSFSNPATDCFLPSLKKISLLYLPELVSISSGL
CIASELESVGIYNCPKLESLSTVEISSENLRVIKGESKWWEALKWKESEWGNRLDYLNGI
FSPIIRENDIKTQLAAEGLVELSFNQ
Download sequence
Identical sequences XP_017970780.1.67643 Tc02_g001140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]