SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc02_g006980 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc02_g006980
Domain Number 1 Region: 65-426
Classification Level Classification E-value
Superfamily L domain-like 1.5e-54
Family Polygalacturonase inhibiting protein PGIP 0.0023
Further Details:      
 
Domain Number 2 Region: 514-642,686-848
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-29
Family Protein kinases, catalytic subunit 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc02_g006980
Sequence length 946
Comment Probable LRR receptor-like serine/threonine-protein kinase At2g16250
Sequence
MVDQRSIGGAFLYLLLLLLFESTFEQQVQQQQQLSSGIELTALFELRSSLGLRSKDWPRK
VDPCSSWNGIRCENGSVIWINISGFRRTRLGKQDPQFAVDSLANFTRLVSFNASRFLLPG
SIPDWFGQRLLTLQVLDLRSCSVTGVIPSSLGNLTNLTSLYLSDNRLTGQIPSTLGQLLS
LSVLHLSKNLLTGSIPSSFGSLMNLTSLDISSNNLTGLIPPAIGALSKLQSLNLSNNSLT
SAIPAQLGDLDSLIDLDLSSNDLSGSVPQDLRGLRNLQRIDFGKNGLSGSLPVNFFPSPS
QLQVIVLRNNSFVGDLPEVLWSIPRLKLLDISRNNFTGTLPNSALNDNATAAELDISQNK
FYGGLTTVLRRFSSTDLSGNYFEGRVPDYMHDNASLSSNCLQIVPNQRTLAECVSFYAEK
GLSFDNFGRPNSTERPVPESGKSNRRLIILAAVLGGAGLIVLLILLLLLVLCFRRRSTTN
HRGIGVEPVPAGETPSPGVAINLSSLGDLFTYQQLLQATGDFSDANLIKHGHSGDLFRGI
LEGGSPVVIKRIDLQSIKKEAYLLELDFFSKVSHTRVVPLLGHCLEKENEKFLVYKYMPN
GDLSSSLYRKNSLEDDSLQSLDWITRLKIAIGAAEGLSYLHHECMPPLVHRYFCSFLPLM
LKFLSVCIILFSHACDKLECRETHRKNFRVQDVQASSILLDDKFEVRLGSLSEVCAQEGD
GHQNRITRLLRFPQSSEQGSSGSSTALCAYDVYCFGKVLLGLVTGKLDISASSDTQMKEW
LERTLPYISIYDKELVTKILDPSLLVDEDLLEEVWAMAIVARSCLNPKPSRRPLMRYILK
ALENPLRVVREDNSSSARLRTTSSRGSWNAALFGSWRQSSSDVAVIPAASTTKAEGGSSF
KQSGTTGSQGSAQNGGGDHSSSRRRHSKEIFPEPSEAQDIERQDRD
Download sequence
Identical sequences Tc02_g006980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]