SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc03_g002370 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc03_g002370
Domain Number 1 Region: 313-635
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.17e-89
Family IF2B-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc03_g002370
Sequence length 642
Comment Putative Translation initiation factor eIF-2B subunit delta
Sequence
MDARRVTRAVPRVRQVGFFTPNAPPEQPGPVRSQSGPPNSNSPPLSGSPASNSLSPVMIP
PPRHLSDNLGARTGAVPVPGRANAGDHATVGSYNPADSVLGLESPPPTRIGDGESSEETE
SSLGWYRRNNPAKFASSFPGGGFDLSPVKQPEIVSGVEAKNQPPEKNEVQKGQASSSKPS
KAKTTKAERRALQESQRAAKAASKAEANKSGGGAASSKTVKQPSQKKDAPPVASSVATSE
RIGVDRPAEKERKKDVPPPRMQFDDESRVGKAKRRSVLNQTEARNSIELFRHLPPHKNGT
QLPYLESKFFELHDKHPAVYKVGLQYLTGDLSGGNARCIAMLQAFQEAIRDYSTPPEKTL
IRDLTSKIGGFVSFLIECRPLSMSMGNAIRFLKSRIAKLPPILSESEAKAALCSDIDRFI
NEKIVLADKVIVRHAATKIRDGDVLLTYGSSCVVEMILLYAHELGKQFRVVVVDSRPMLE
GKKLLRRLVAKGLSCTYTHLNAISYIMHEVTRVLLGASSILSNGTVYSRVGTASVAMVAY
AYRVPVLICCEAYKFHERVQLDSICFNELGDPDAIAKVPGRVDVNYLDNLSDKQKENLKL
LNLKYDATPSDYISMIVTDYGMIPPTSVPVIVREYRKEYLLI
Download sequence
Identical sequences XP_007036420.2.67643 Tc03_g002370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]