SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc03_g023320 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc03_g023320
Domain Number 1 Region: 63-166
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.84e-27
Family 2Fe-2S ferredoxin-related 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc03_g023320
Sequence length 188
Comment Putative Ferredoxin-2
Sequence
MDLVVPCNSCTPLYRQPPLHRRLSSPKRCSFPFNSFKCRRRTTSELQTPVSITSPDGNLS
PSIPTHKVTVHDRKQGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRVKSGQ
IRQPEALGISTELKAKGYALLCVGFPSSDLEVETQDEDEVYWLQFGRYFARGPIDRDDYA
LELAMGDE
Download sequence
Identical sequences Tc03_g023320 XP_007039531.2.67643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]