SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc04_g015310 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc04_g015310
Domain Number 1 Region: 315-637
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 4.67e-88
Family IF2B-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc04_g015310
Sequence length 644
Comment Putative Translation initiation factor eIF-2B subunit delta
Sequence
MDPRRSARTVSDPKVRQVGFFTQPPPPDRSISDPPRHHDPIQSSSPSSPPVNDHSPSGNS
LSPVMIPPPRHHSDTLLRTALQPTSPTTSFSYSARTVTVPQENDDVSSFSPGRRVVSGKS
PSSFPGVKASSVPASELTTVSVVNLPPGISEKSGGAAVEVQNDQLARSKPLKEKTSKAER
RALQEAQRAAKAAAKAEGSKAPAAASKVGPSANTKPSKAAKPPSQKNDGSQVAPSEKKGG
DRAPEKDRKKDAPHPRMQYDDASRVEKAKKRAVVKQTEARNRVELFRHLPQYEHGTQLPD
LETKFFELNPMHPAVYKVFLQTQLWVGLQYLSGDICGGNARCIAMLQAFKEAIKDYLTPP
EKTLIRDLTARISSYVSFLIECRPLSISMGNAIKFLKSRIAKLPLSLSESEAKASLMLDI
DRFINEKIILADKVIVKHAVTKIRDGDVLLTYGASSAVEMILLHAHELGKQFRVVVVDSR
PKLEGQLLLRRLVRKGLSCTYTHVNAVSCIMHEVTRVFLGASSVLSNGTVYSRVGTACVA
MVAHALHVPVLVCCEAYKFHERVQLDSICSNELGNPDAISKVSGREEISYLDGLVNSDNL
QLLNLIYDATPSDYVSMVITDYGMVPPTSVPVIVREYRREHLWS
Download sequence
Identical sequences Tc04_g015310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]