SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc05_g021040 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc05_g021040
Domain Number 1 Region: 14-93,139-621
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.7e-94
Family Acetyl-CoA synthetase-like 0.0000098
Further Details:      
 
Domain Number 2 Region: 857-1219
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.59e-36
Family Quinoprotein alcohol dehydrogenase-like 0.013
Further Details:      
 
Domain Number 3 Region: 670-722
Classification Level Classification E-value
Superfamily ACP-like 0.0000925
Family Peptidyl carrier domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc05_g021040
Sequence length 1222
Comment AMP dependent ligase, putative
Sequence
MVRPEDEHEKQRQHCCISHEFYRAASKNPEKIAVIHASSSKPSAGGVQIDRELIGGGNPP
VYKGDQCFTFGTLLASVDCLSFRLRSILEGADDPYLVKSQPPGDNGKHTVPVQTSEASLT
FMQEVGRHTELENTYIPKIVGLFMPPSVEYVISVLSVLKCGEAFLPLDPSWPRDRILSIV
DSSNAALVIACGSSFGKSGCEPLDQSHWLLECSSCPVLCFSMEESSEKNNIESSFGWPCE
NERKRLFSYLMYTSGSTGNPKGVCGTEQGLLNRFLWMQELYPMHGEELLLFKTSISFVDH
LQEFLAASLTACTLVVPPLTELRQNVFSIIEFLEAYSINRLTAVPSLMRVILPAMQSQHD
NLISSSLRLLVLSGEVLPLALWNMLSSLLPKTSVLNLYGSTEVSGDCMYFDCKRLPSILE
VQTLTTVPIGLPISKCSIVLNGENSNPNEGEIYVRGLCVSIGYFSENAIIPLNNAKLHQN
SLCKCSMEACGSQVYFRTGDFAHQLPSGDLVFLGRKDRTVKVNGQRIALEEVENTLRGHN
DVIDAAVISHKDQGEDALIVAFILLREKEESGEMFKTSIRNWMISKLPTAMVPTHFVFVK
SLPMSASGKVDYTVLVESILSKSHVQDEISNTGPSNLMQVIKKVCFVLSHAFAAFSDLCF
HIGIIGSYTVDAFCEALMVEDVSDDDDFFMIGGNSIAAAHVSHNLGIDMRLLYTFSTPAK
LLITLVEKKGSKNTNFRIKDNAELIIQPDKGSAYSSVESETPDPLGSKLQRTLSWTLYER
NDDQAVRSKRLKVDSNKYYILDPVHLFNGYPWNSTSILKSCSFSRCNKVMRAGENEVNDT
WQVAQSVEVPRTRTGYMQELWKVHMESCVDASPLIVFKDSDIYLFVGSHSHKFLCVNAQS
GSIQWETRLQGRVEGSAAIVGDFSQVVVGCYDGNLYFLEFLNGNICWTFHTSGEVKCQPI
MDNHRGLIWCGSHDRNLYALDYRNRCCVCKLPCGGSIFGSPAIDEVHHALYMASTSGRVT
AISIKELPFCTLWSYELEVPVFGSLSISPRHGYVICCLVDGHVVALDSSGSIVWKRRTGG
PIFAGACISYALPSQVLICSRNGSVYSFEMEKGELLWEINVGDPITASAYVDENLQLISN
PTISVDRLVCVCTSSGSILLLRISLDEGKGSHQRKYMVQEFVRLKLEGDLFSSPVMIGGR
IFVGCRDDYLHCIAVETQESVG
Download sequence
Identical sequences Tc05_g021040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]