SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc06_g011190 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc06_g011190
Domain Number 1 Region: 644-933
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-79
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 92-372
Classification Level Classification E-value
Superfamily L domain-like 3.85e-45
Family Polygalacturonase inhibiting protein PGIP 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc06_g011190
Sequence length 1006
Comment Probable LRR receptor-like serine/threonine-protein kinase At1g56140
Sequence
MYGKLTVRALNSIFQQWEALAPETWNISGEPCSGFALSDSDSVFEDSSNNPSIRCDCSFE
NGTTCHITRLYIYMLSLALFLTLHYNNSIRRVFSLEKRGQIPEELLALRFLTFLKIDQNF
FTGPLPTFIGNMSRLALLSVAQNSLSGPIPKEIGNLKDLYLSLGTNNFSGTIPPELGNLV
KLQQLYINSCGFTGEIPSTFANLRNLKIVLLNFRGASDNAFTGKIPDFIGNNWTTLQSLR
LEGNSFEGPIPSNIGNLTSLTILRISGIYNGSSSLDFVRKLKNIADLVLRNVLLTGSIPT
DIAEFQALQKLDLSFNNLTGQIPSELFNMNSLTYLFLGNNSLSGTLPSQKSQSLKNIDVS
YNHLSGTLPSWMDSSLQLNNIFKFHRLLPGLQCLQTGFPYANFAIKCGGPQMIADGILFE
AENSTLGAATFNVTSTQKWAVSNVGLYEDRENPMYVQNTFAQVKSTNTPEIYQTSRISPL
SLRYYGLGLENGPYTVNLFFAETAYPDRSTQSSKSLGRRVFDIYIQGSLKVKDFDISKEA
GGAERAIARNFTANVTENHLEIHLFWAGKGTCCVPELGYYGPSISAISVVPDFIPTVSGL
PPGSSKRKNRAALIVGVVVPVGVAALILICVIIHFERKKEYDDEEGMSIPNTFSYAELKA
ATEDFSPSNKLGEGGFGAVYRGTLSDGRVVAVKQLSVASHQGKGQFIAEVATISAVQHRN
LVKLYGCCIEGKRHLLVYEYLENKSLDQALFGRSDLHLDWATRFNICLATARGLAYLHEE
SRPRIVHRDVKASNILLDAELCPKISDFGLAKLYDDKKTHISTGVAGTIGYLAPEYAMRG
HLTEKADVFGFGIVALEILSGRPNSDNSLEDGKIYLLEWAWALHENNQSLDLVDPNLVEL
DENEALRVMGVALLCTQGSPTMRPPMSRVVAMLAGDIEVNGVIKRPSYLTDWDFKDLTGS
FMTEDTQNSIASENIDNNGNININPRAAPNLSSVNVTECSDIMEGR
Download sequence
Identical sequences Tc06_g011190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]