SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc06_g013710 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc06_g013710
Domain Number 1 Region: 696-990
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.13e-76
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 140-386
Classification Level Classification E-value
Superfamily L domain-like 2.99e-46
Family Polygalacturonase inhibiting protein PGIP 0.0045
Further Details:      
 
Weak hits

Sequence:  Tc06_g013710
Domain Number - Region: 473-616
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000187
Family Beta-galactosidase LacA, domains 4 and 5 0.096
Further Details:      
 
Domain Number - Region: 367-432
Classification Level Classification E-value
Superfamily L domain-like 0.0544
Family Polygalacturonase inhibiting protein PGIP 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc06_g013710
Sequence length 1075
Comment Probable LRR receptor-like serine/threonine-protein kinase RFK1
Sequence
MLFSKAMILLSAVLALSWIGTHKLEAAMLPEDEVNVLNQIARTMGATNWTFDGDDCQKND
TPRVERGFVPEKNVTCHCENETCHVTHFDERREAVMLRTTYFMKGFGLFVIRKSPMDPSE
PSLSFVIKKKPLTVKAFKRQNLPGALPSELVHLPYLKEIDFAYNYLSGSIPSEWGSMQLE
KISVFGNRLLGRIPSSLGNISTLKYLDLEVNNFSGQVPREFGKLFNLETLRLSSNRLTGN
LPSELADLKNLTDLINDNNLNGSIPDFIHNWNKLDRLEMQGSGHEGPIPSSISALENLEI
LIISDIDGTSQPFPDLRNMTRIKRIILKKCNISGQIPEYVWDMSDLRILDLSFNSLNGVL
EHVIPPGNFKFLFLTGNNLSGNIPQSILRTGITVDLSYNSFAWQSPQQPACRQLSNINLF
RSSSSTNLDEIFQCKNDFQCEEHSHSLYLNCGGDDVKIDGKTYIGDRTFGSGGAATLYRN
DDNWGFSSTGDFREDNDELNLQSRFIATVQSPNNLSDLYTTARLSPLSLTYYQYCLENGN
YTLTLHFAEIQFSNNATYGSLGRRMFDIYIQDELIEQDFDIEAEAKGVLTPYTRSYNVSV
TNGRIEIRFYWAGKGTQAIPDRGTHGPLISAISLENPNFKHRDAGKKTNVVPIVVGVLGA
FTIFLASGILWWRYYFKAKSRREKDLEGLDVQTVSFTLKQIKAATNNFDSANKIGEGGFG
PVYKQGQLADGTIIAVKQLSSKSSQGNREFMNEIGMISCLQHSNLVKLYGCCIEGDQLLL
VYEYLENNSLSRALFEKSQMNLDWPTRHKICTGIARGLAFLHEESRLKIVHRDIKGTNVL
LDRDLNPKISDFGLAKLHEEEKTHISTRVAGTIGYIAPEYALWGYLTYKADVYSFGIVAL
EIVSGKHNMTYGPENKYTCLLDWQNRKLSELVDEKLGTEFNKAEAEAMIKIALLCTNGSP
SLRPMMSEVVGMLEGKIIVPESVPDPGSYSQDLRFKAIRDHHKSMNSQNLGGSQVNSSTS
AGSRIEASSDYAYERNEIIEFKAMESQISTSVPSWTGSSIMSVSSHDFYDLHPRS
Download sequence
Identical sequences Tc06_g013710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]