SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc08_g001260 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc08_g001260
Domain Number 1 Region: 21-113
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1e-18
Family B3 DNA binding domain 0.0014
Further Details:      
 
Domain Number 2 Region: 269-358
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1e-17
Family B3 DNA binding domain 0.0059
Further Details:      
 
Domain Number 3 Region: 503-535
Classification Level Classification E-value
Superfamily PetM subunit of the cytochrome b6f complex 0.000000000314
Family PetM subunit of the cytochrome b6f complex 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc08_g001260
Sequence length 539
Comment Putative B3 domain-containing protein REM16
Sequence
MGDSCKDCRSWEEEIFWTHFQSIHFSQFLHGDFLQRLEVPEKFAKNMKQKLPETVTLKGP
SGIIWDVGLKADGDTLFFDCGWKIFVKDHSLVENDLMIFKYNGMSQFDVLMFDGRSLCEK
AASYFVRKCGHTEYDSGCQTKRKMNETPVEIVHNSSHCGLESSPEKSINNNIDTRPSRQP
ITSAATNKKLRIVGSSTRSIPARKSLRGKDLTTFAAEVKVETGDLEFDHTSMDGDVFSPR
HTARKRRATQVEKANVFLMAQEALPREGFMVVMKPTHVARRFYMAIPTAWVAKHLSKQNE
DVILRINKQTWKTRFYYHRNRGCGGLSGGWRNFVNDNNLDEDDACVFEPADIGNKPMILD
VSIFRVLQAPVPLIQVQPNLKPQLSPRNGIVCCSISFYLQNPARSNSQVDMATTSAVLAQ
VTTSGAVVRCGSNKTKQTTPKVVYIGGMSSYGGLKAHSNNNVVSLGLPRCTEQCFANVIS
SLKKAHGEGRTGGGALSSTCNKADEIFNIAVIMNGLVLIGVAVGFVLLRIEASLEESDQ
Download sequence
Identical sequences Tc08_g001260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]