SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc08_g010510 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc08_g010510
Domain Number 1 Region: 87-194
Classification Level Classification E-value
Superfamily POZ domain 7.4e-27
Family BTB/POZ domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc08_g010510
Sequence length 272
Comment Predicted protein
Sequence
MRRHRCHQAVRSESETESETDTETMRCISCKEEYGARDAGTCKECYEEASETEEELKREI
EDLKAKVAFLRFWSPLDHAHRGSTSPGPFFPDVVLVASDDGSPGLPPVPVPSHKAVLASR
SPVFKAMFENEMEESRSGTIKISDVSYDALRAFVNYLYTAEAWLDEQMACDLLVLAEKYQ
VKHLKGYCEKFLVSKLNWDNSLMSYAFAHQHNAKLVLDAALCLITDNMDKLTKREEYMEL
VEKDPRLVVEIYEAYLSKQVNTAAHKDSSVKS
Download sequence
Identical sequences Tc08_g010510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]