SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc10_g015700 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc10_g015700
Domain Number 1 Region: 7-95,176-406
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 6.51e-84
Family IF2B-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc10_g015700
Sequence length 417
Comment Putative Translation initiation factor eIF-2B subunit beta
Sequence
MPDTQALVNDFLNQLKKRKIEGSQATAKQTAELLRSVISQTRVPYTNQAGALIDSVKAVG
ERLIAANPVELAVGNIVRRVLHIIREEDVSLTTAAMAGLNLSAVSDDEDDADRDDRPVLS
AAAVAAASRSTLRPPSLQTLLEDVPDSAAVPHTSSSGGDSEGKSKSADKSSRSRKLKHDV
IEAVNELIQDINTCHEQIAEQAVEHIHQNEVILTLGSSRTVLEFLCAAKEKKRSFRVFVA
EGAPRYQGHLLAKELVARGLQTTLITDSAVFAMISRVNMVIVGAHAVMANGGVIAPVGLN
MVALAAQKHAVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCMDFGSGNG
APLLHVVNPTFDYVPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRRPTSGN
Download sequence
Identical sequences A0A061FSM2
Tc10_g015700 XP_007011104.1.67643 XP_017984556.1.67643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]