SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568126753|ref|YP_008923400.1| from Achromobacter xylosoxidans NBRC 15126 = ATCC 27061

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568126753|ref|YP_008923400.1|
Domain Number 1 Region: 134-359,396-527
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.6e-47
Family AAT-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568126753|ref|YP_008923400.1|
Sequence length 604
Comment Aspartate/tyrosine/aromatic aminotransferase [Achromobacter xylosoxidans NBRC 15126 = ATCC 27061]
Sequence
MASTAPLTVSLASALKTTRSRQRDLEQLSPFELKDYLITLAKDTQQTAALTMLNAGRGNP
NWIATEPRDAFFLLGQFAMKEARRVRDDVILAGMPPKKGCADRLRKFLSKNKGAAGADFL
AGVLEYGVKIKNFVPDEWIHELTDSVIGDNYPVPPRALVHLEQVVHDYLIKEMCDGRPPK
GKFDLFPVEGGTAAMCYIFDSLMQNGLLKQGDTIALFLPTFTPYIEIAHLERFQFKIVAI
NASSVRADGTHDWHYPASEIAKLENPKIKLAVTVNPSNPPSVAFSPVEMKQIVGLIRKNP
DLVLVTDDVYGTFVPNFRSLMAEVPHNTICVYSFSKNFGCTGWRLGVIATHEKNTMDRRI
AELPASWKNRLNKRYGAMTMEPEKLKFIDRMVADSRNVALNHTAGLSLPQQVQMGFFALS
HLLDLKDAYKHLTMQIVRARRDALWRGLGVPLPPEDPMRGWYYVELDFMVWAKNTYGDAF
CKYMTSNYEPVDFLFRLAEKSGVVLMDGGGFGGPPWSIRISLANLDDGDYSKIGKHMVDA
ATEYVEAWKAGQLVRSGPTAGKGQKVKPAAAKRKAAGKQAAKKAVKQAVKKAAKAERSAT
KGAK
Download sequence
Identical sequences A0A0D6GQG3 A0A0M7ENT7
gi|568126753|ref|YP_008923400.1| WP_024068181.1.1102 WP_024068181.1.2141 WP_024068181.1.24717 WP_024068181.1.2494 WP_024068181.1.29298 WP_024068181.1.30196 WP_024068181.1.41161 WP_024068181.1.50137 WP_024068181.1.52298 WP_024068181.1.56128 WP_024068181.1.57976 WP_024068181.1.59228 WP_024068181.1.60257 WP_024068181.1.60839 WP_024068181.1.70984 WP_024068181.1.71915 WP_024068181.1.73619 WP_024068181.1.87081 WP_024068181.1.90725 WP_024068181.1.92290 WP_024068181.1.92670 WP_024068181.1.99476 WP_024068181.1.99933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]