SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000196 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000196
Domain Number 1 Region: 432-524
Classification Level Classification E-value
Superfamily Acid proteases 4.57e-23
Family Retroviral protease (retropepsin) 0.00075
Further Details:      
 
Domain Number 2 Region: 1-138
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 3.06e-20
Family Retrovirus capsid protein, N-terminal core domain 0.012
Further Details:      
 
Domain Number 3 Region: 147-218
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00000000000000179
Family Retrovirus capsid protein C-terminal domain 0.0018
Further Details:      
 
Domain Number 4 Region: 266-285
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000023
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000196   Gene: ENSSHAG00000000165   Transcript: ENSSHAT00000000199
Sequence length 533
Comment pep:novel scaffold:DEVIL7.0:GL837085.1:28:2390:1 gene:ENSSHAG00000000165 transcript:ENSSHAT00000000199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPVIQQFNSSGQESRKYAPFDIEIFKDLKKACTLYGTTSAYVKMLLQNLAFEILTPNDWK
SIARVSLEPQNYLRLSEYSKLCRIQAPKNSQSAVHAAITCDVLTCVDSYADVTVQINYSI
AAYEQIAAKAIKTWTSLYNKDDKGEAFTKITQGPDEPFADFVGHLQTAITTTNGENVVTD
ILIRENANEVCRRTMLGLCKDAPLEELIRHCATVGTNAFYSQIMMQTSQDPNMGRQGTSR
ETLQCFQCGRCWYTDRMRKQGGRKRPNIPCPKCNRGFHWASECRQVQGNGMRGPAPGPQA
KNTWGMMAANGAPRVPRSPIPRHDLSARKPYDGTKGLHNQPARKQDDGKKGLQLGKIELY
AAGTTEIPRPLDLLPPGTLGLTISPPFYKYKTVSIHTLMWETGECVDNIPVTNTGRQCVT
YHPGEIVASAVTTDQPMLTIYINGLPLEGLVDTGADHTVIRGVNWPNTYMSGVGGSIAAE
VSAAPIRWTFKGKTGVFNSFIVEKIPINLQGRDILQQLGLKLKMLEADVRTTH
Download sequence
Identical sequences G3VAJ2
ENSSHAP00000000196 ENSSHAP00000000196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]