SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000251 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000251
Domain Number 1 Region: 94-114
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000691
Family Retrovirus zinc finger-like domains 0.0024
Further Details:      
 
Domain Number 2 Region: 1-42
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.000000842
Family Retrovirus capsid protein C-terminal domain 0.0053
Further Details:      
 
Domain Number 3 Region: 61-87
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000199
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000251   Gene: ENSSHAG00000000217   Transcript: ENSSHAT00000000256
Sequence length 133
Comment pep:novel scaffold:DEVIL7.0:GL834995.1:93:494:-1 gene:ENSSHAG00000000217 transcript:ENSSHAT00000000256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRQLAKENANEVCRRNIRGLHKDVPLEEIIGCCARVGTNAYYTQTMMNMERQGPSWQKT
FREIRRCFLCGKVGHLRAQCRYRDRVRRQGERRPKTLCPKCNRGFHWASECRLTQGNERQ
GPAPRSQTKDRWG
Download sequence
Identical sequences G3VAP7
ENSSHAP00000000251 ENSSHAP00000000251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]