SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000313 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000313
Domain Number 1 Region: 7-151
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 2.98e-28
Family Retrovirus capsid protein, N-terminal core domain 0.014
Further Details:      
 
Domain Number 2 Region: 309-393
Classification Level Classification E-value
Superfamily Acid proteases 3.27e-18
Family Retroviral protease (retropepsin) 0.00077
Further Details:      
 
Domain Number 3 Region: 160-228
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.000000000000183
Family Retrovirus capsid protein C-terminal domain 0.0022
Further Details:      
 
Domain Number 4 Region: 241-297
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000115
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000313   Gene: ENSSHAG00000000277   Transcript: ENSSHAT00000000318
Sequence length 393
Comment pep:novel scaffold:DEVIL7.0:GL859073.1:276:1922:-1 gene:ENSSHAG00000000277 transcript:ENSSHAT00000000318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQKALLKAKEEGHNTEMYPVIEQLNSSGQERRRYIPFNLEIIKDLKKACTLYGSTSSYVR
TLLQNLAYEILIPSDWKSIARTCLETEQKLWLSEYSKLCRIQAQTGVNTPITCDQLTGVG
SYADTSAQINYPIAAYEQIASAAIKAWGFLPGKENRGEAFTKIEESPNEPLANFVGRLQT
AIGENAATEIMSRQLAKENANKECRRIIVGLHKDDPLEKIIRGCATVGINIFYTQPMIQT
SQGTSRETRQCFQCGKIGHLKAQCWHRDRVRKQDGRTGPKTPCPKCNRGFHWASECRLIQ
IIFQSGIQLTIYINGIPLKRLVYTGADCTVIRDANWPNHWSKIKADTYIWVGGSIVVEVS
ATPLRWTFEGETGVFTPFIVEKISINLWGRDIL
Download sequence
Identical sequences G3VAV9
ENSSHAP00000000313 ENSSHAP00000000313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]