SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000391 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000391
Domain Number 1 Region: 3-142
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 2.2e-28
Family Retrovirus capsid protein, N-terminal core domain 0.01
Further Details:      
 
Domain Number 2 Region: 150-225
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.76e-17
Family Retrovirus capsid protein C-terminal domain 0.0027
Further Details:      
 
Domain Number 3 Region: 282-341
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000116
Family Retroviral protease (retropepsin) 0.0061
Further Details:      
 
Domain Number 4 Region: 228-267
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000314
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000391   Gene: ENSSHAG00000000344   Transcript: ENSSHAT00000000396
Sequence length 341
Comment pep:novel scaffold:DEVIL7.0:GL862730.1:573:2192:1 gene:ENSSHAG00000000344 transcript:ENSSHAT00000000396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGMYPVIQKFNSSGQESKRYTPFDIEILKDLKKACTLSGATSAYVKLLLQNLAYEVLTFR
DWKSIARTCLEPGQNLLWLSEYSELCRIQAQQNSHSGVNPPITYDQLTGVGSYAEISVQI
NYPLAAYEQIAAAIKAWASLPNKDDKGEAFTKITHGPNEPFADFVGRLQTAVIQTNGDNA
VTDIMIRQHAKENANEVCRRITLGLRKDAPFEDIIRHCATVGTNAFYSQGIQGPFWQGTS
RETHQCFQCGKVGHLKAQCWHRDRVRKQGGITKPIPHQQNLGVYWTAAVTADLPMLTIYI
NGIPLEGLVDTGVYRTVIRGANWPSQRPKIKADTYMSGVGG
Download sequence
Identical sequences G3VB37
ENSSHAP00000000391 ENSSHAP00000000391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]