SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000495 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000495
Domain Number 1 Region: 30-105
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.23e-22
Family Retrovirus capsid protein C-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 165-184
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000331
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 
Domain Number 3 Region: 129-185
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000015
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000495   Gene: ENSSHAG00000000444   Transcript: ENSSHAT00000000503
Sequence length 219
Comment pep:novel scaffold:DEVIL7.0:GL860156.1:1030:1803:-1 gene:ENSSHAG00000000444 transcript:ENSSHAT00000000503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YSIAAYEQIVANDIKVWASLHNKDDKSEAFTKITQGPNEPFADFVGRLQTAITRTNGENA
VTDILIRQLAKENANEVCRRIILGLRKDAPLEELIRRCATVGTNAFYSQAMMQTSQDPNM
GRQGSFWQGTSRDTHQCFQYGKVGHLKAQCWHRDRVRKQGGKTRPNIPCPKCNRGFHWAS
ECRQVQENGMRGPDPGPQAKNTWARKQPDGRKELQLGRI
Download sequence
Identical sequences G3VBE1
ENSSHAP00000000495 ENSSHAP00000000495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]