SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000525 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000525
Domain Number 1 Region: 17-142
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 2.59e-24
Family Retrovirus capsid protein, N-terminal core domain 0.0078
Further Details:      
 
Domain Number 2 Region: 166-241
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.26e-17
Family Retrovirus capsid protein C-terminal domain 0.0025
Further Details:      
 
Domain Number 3 Region: 317-372
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000000915
Family Retroviral protease (retropepsin) 0.0053
Further Details:      
 
Domain Number 4 Region: 261-313
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000649
Family Retrovirus zinc finger-like domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000525   Gene: ENSSHAG00000000469   Transcript: ENSSHAT00000000534
Sequence length 372
Comment pep:novel scaffold:DEVIL7.0:GL861223.1:1204:2873:-1 gene:ENSSHAG00000000469 transcript:ENSSHAT00000000534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQSPPPMTRLQKALFKATEAAQNTDDVKIEMYPVIGQFNSSGQESRRYAPFELEILKDLK
KACTLYGTKSAYVKMLLQNLAYEVLTPTDWKSIARTCLEPGKNLLWLSEYSENSQSEVNP
PITYDQLTGVDSYADISVQIQHMSKLLLMLSKHGFLSNKNDKGEAFIKIAQGPNEPSVDF
VGCLQIAVTQINGKNAVTEIMIRQLAKENANEVCRRIILGLHKDAPLEEIIRCCATVSTN
TFYSQGSEHGKTGSLLARDFQRDLHQCFQCGKVGHLKTQCWHRDKVKKQGGRTRPKTPCP
QCNRSFHRASECRLIQTAAVTSDQPLLIIYVNGMPLEGLVDTGADNTVIRGANWPRHWLK
IKADTYMFGVGG
Download sequence
Identical sequences G3VBH1
ENSSHAP00000000525 ENSSHAP00000000525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]