SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000526 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000526
Domain Number 1 Region: 6-158
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 1.41e-22
Family Retrovirus capsid protein, N-terminal core domain 0.012
Further Details:      
 
Domain Number 2 Region: 175-249
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00000000000000168
Family Retrovirus capsid protein C-terminal domain 0.0022
Further Details:      
 
Domain Number 3 Region: 266-303
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000553
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000526   Gene: ENSSHAG00000000470   Transcript: ENSSHAT00000000535
Sequence length 364
Comment pep:novel scaffold:DEVIL7.0:GL864220.1:1215:2865:-1 gene:ENSSHAG00000000470 transcript:ENSSHAT00000000535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLQESPPPMTRLQKAVLKAKEEGQDLGMYPVIQQFNSSGQESRRYIPFDIEILKDLKKAH
TFGATSAYVKMLLQNLAYEVLTPSDWKSIARTCLEPRQNLYLSQYSELCRIQAQQNSQSG
INTPITYDQLTGVGSYAEISVQINYSIAAYEQIASAAAIKVWASLHNKNDKGEAFTKIAQ
GPNEPLADFVGRLQTAIILTNDENEITDILIRNLAKENANEVCRRIILGLCKDAFLEEII
RCYATVDTNAFYSQAMMQTSQDPNMGRQGPFWQGTSREIRQCFQCGKVGHLKAQCWHKDR
VGKQGGRTIPKTPCPKCNRDRMRGPALAQGKKDLGILLEGLVDTGVDTGADRTVIRGANW
PSHW
Download sequence
Identical sequences G3VBH2
ENSSHAP00000000526 ENSSHAP00000000526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]