SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000554 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000554
Domain Number 1 Region: 2-128
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 1.26e-25
Family Retrovirus capsid protein, N-terminal core domain 0.012
Further Details:      
 
Domain Number 2 Region: 137-212
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.4e-17
Family Retrovirus capsid protein C-terminal domain 0.0029
Further Details:      
 
Domain Number 3 Region: 219-274
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000188
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000554   Gene: ENSSHAG00000000496   Transcript: ENSSHAT00000000563
Sequence length 312
Comment pep:novel scaffold:DEVIL7.0:GL853578.1:1346:2824:-1 gene:ENSSHAG00000000496 transcript:ENSSHAT00000000563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQEKRRYTPFNLEIIKDLKKACTLYGSISSYIKMLLENLAFDVLAPEWKSIERTRLEPGQ
NLLWLSEYSELCRIQAQQNRKTGVNSPITCDQQTGVGPYADTSAQINYPIAAYEQIASAA
IKAWGNLPGRQDRGEGFIKIAQHPNEPFADFMGHLQIAVTRTIGENAATEFMIRQLAKEN
ANEVCRRTILGLHKDAPLDEIIRRYATVGTNTFYSQAKQGPSRETLQCFQCDNVGHLKAP
CWHKDRVRKQGGRTRPQIPCLKCNRGFHWASECRLIQGNGMRSPRFTIYVNGIPLEELVD
TGPDCIVIRGAS
Download sequence
Identical sequences G3VBK0
ENSSHAP00000000554 ENSSHAP00000000554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]