SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000577 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000577
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 1.73e-20
Family Retrovirus capsid protein, N-terminal core domain 0.013
Further Details:      
 
Domain Number 2 Region: 122-196
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.4e-20
Family Retrovirus capsid protein C-terminal domain 0.0015
Further Details:      
 
Domain Number 3 Region: 268-351
Classification Level Classification E-value
Superfamily Acid proteases 1.13e-19
Family Retroviral protease (retropepsin) 0.0014
Further Details:      
 
Domain Number 4 Region: 210-239
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000192
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000577   Gene: ENSSHAG00000000515   Transcript: ENSSHAT00000000586
Sequence length 369
Comment pep:novel scaffold:DEVIL7.0:GL860844.1:1466:3536:1 gene:ENSSHAG00000000515 transcript:ENSSHAT00000000586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKKSCTLYGATSAYVKMLLRNLAFEILTPNDWKSIARIRLEPQQKYLWLSEYSELSRIQA
QQNSHSGVNPPITCDLLTGVGPYADIKVQINYFIAAYEQIAANAIKAWALIHNKDEKGET
FKKITQGPDEPFADFVGHLQTAITRTNGENASTDVLISQLSNENANEDCRRIIQRLHKDA
PLEELIKCCATVGTTAFYSQAMMQTSQDPNMQGTSRETCQCFQCGKVGHLKAQCWYRARN
PNKQPGDSHPDSDSRPQNPAIYWTAAVTTDRPMLTIYINGLPLEVLVDTGADRTIIRGAN
WPSHWPKINAHTYMSGIEGSIVAEVSAAPMRWTFEGKTGVFTPSLIPSTPSPRWQDDQVL
FLGIASSVH
Download sequence
Identical sequences G3VBM3
ENSSHAP00000000577 ENSSHAP00000000577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]