SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000653 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000653
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 8.63e-23
Family Retrovirus capsid protein, N-terminal core domain 0.019
Further Details:      
 
Domain Number 2 Region: 122-197
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.41e-20
Family Retrovirus capsid protein C-terminal domain 0.0018
Further Details:      
 
Domain Number 3 Region: 262-299
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000976
Family Retroviral protease (retropepsin) 0.011
Further Details:      
 
Domain Number 4 Region: 246-264
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000103
Family Retrovirus zinc finger-like domains 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000653   Gene: ENSSHAG00000000582   Transcript: ENSSHAT00000000663
Sequence length 299
Comment pep:novel scaffold:DEVIL7.0:GL859520.1:1893:3376:-1 gene:ENSSHAG00000000582 transcript:ENSSHAT00000000663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEKACTLYGATSAYVKMLLQNLAYEVLTPRDWKSIAEGTCLEPGQNLLWLSEYNELCRIQ
AQQNSGSGVNHPVTYDQLTGVGSYAEISVQLNYPIAAHEQIAAAAIKAWAFLPGKNDKGE
AFTKIAQGPNEPFADFVGHLQTAVVRTNGENAVTEIMIKQLAKENANDVCRKIILGLHKD
APLEEIIRHCAIVGTNAFYSQAMMQTSQDANMGTYRETRQCGKVRHLKAQCWYRDRMRKQ
GGRTRPNTPCPKCNRGFHWASECMTADRLMFTIYINSIPLEGLVDTGADRIVIRGDNWP
Download sequence
Identical sequences G3VBU9
ENSSHAP00000000653 ENSSHAP00000000653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]