SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000663 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000663
Domain Number 1 Region: 19-95
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.94e-18
Family Retrovirus capsid protein C-terminal domain 0.0028
Further Details:      
 
Domain Number 2 Region: 113-167
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000523
Family Retrovirus zinc finger-like domains 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000663   Gene: ENSSHAG00000000592   Transcript: ENSSHAT00000000673
Sequence length 199
Comment pep:novel scaffold:DEVIL7.0:GL854511.1:1946:2846:1 gene:ENSSHAG00000000592 transcript:ENSSHAT00000000673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAIKAWGSFPGQKDGREAFMKIEQGPNKLFVDFVGCLQTAVTRIIGENTTTGIMTRQLAK
ENANEVCRRIIWGLHKDAPLEEIIRRCATVGTNAYYTQTMMTMGRQGPSWQGTSRETHQC
FQCGKTGHLRAQCRYGDRVRGQGKRRSKTLYPKCNKGFHWASECRLTQGNERQGAAPRYH
TKDRWRRNQMGANESYLPC
Download sequence
Identical sequences G3VBV9
ENSSHAP00000000663 ENSSHAP00000000663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]