SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000684 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000684
Domain Number 1 Region: 1-117
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 4.55e-19
Family Retrovirus capsid protein, N-terminal core domain 0.018
Further Details:      
 
Domain Number 2 Region: 125-201
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00000000000000119
Family Retrovirus capsid protein C-terminal domain 0.0029
Further Details:      
 
Domain Number 3 Region: 260-294
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000334
Family Retroviral protease (retropepsin) 0.01
Further Details:      
 
Domain Number 4 Region: 214-233
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000921
Family Retrovirus zinc finger-like domains 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000684   Gene: ENSSHAG00000000611   Transcript: ENSSHAT00000000694
Sequence length 294
Comment pep:novel scaffold:DEVIL7.0:GL860091.1:2058:3524:1 gene:ENSSHAG00000000611 transcript:ENSSHAT00000000694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKYAPFDIEILKNLKKVCTFYEVTSAYVKMLLQNVAFEILTPNDWKSIARVCLESGQNYF
WLSEYRELYRIQAQQNSQSRVHAAEFTCDLLTGIKYSIAAYEQIAANAIKVWASLQNKDN
KGEAFTKITLEPNEPFADFVRHLQTAITRTNGENAVTDILIRQLAKENANEVYRRIILGL
HKDSPLETLIRHCATVGTNYFYNRIRKQYGRTKPSTSCPKCNKGFHWASECRLIQPMDSL
AQGTVGLTISPPEREVVASSLLRQTPTDRPMLSIYINGTPLEGLVDTGADCTVI
Download sequence
Identical sequences G3VBY0
ENSSHAP00000000684 ENSSHAP00000000684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]