SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001258 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001258
Domain Number 1 Region: 442-702
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-49
Family YWTD domain 0.0000000958
Further Details:      
 
Domain Number 2 Region: 233-272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000301
Family LDL receptor-like module 0.00052
Further Details:      
 
Domain Number 3 Region: 30-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000746
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 4 Region: 147-187
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000131
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 5 Region: 271-311
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0005
Further Details:      
 
Domain Number 6 Region: 69-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 7 Region: 186-224
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000089
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 8 Region: 395-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000729
Family EGF-type module 0.0012
Further Details:      
 
Domain Number 9 Region: 106-148
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000785
Family LDL receptor-like module 0.00018
Further Details:      
 
Domain Number 10 Region: 359-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family EGF-type module 0.003
Further Details:      
 
Domain Number 11 Region: 317-353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000367
Family LDL receptor-like module 0.00036
Further Details:      
 
Domain Number 12 Region: 705-751
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000802
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001258   Gene: ENSSHAG00000001123   Transcript: ENSSHAT00000001273
Sequence length 846
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841520.1:7289:45144:1 gene:ENSSHAG00000001123 transcript:ENSSHAT00000001273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTSSLWGLWLLVAMWCLSGERSIVEGTRTKCESSQFQCSNGRCITLLWKCDGDEDCSDG
SDESSCVKKTCAESDFVCNNGQCVPNRWQCDGDPDCEDGSDERPEQCNMRTCRINEISCG
VRSTQCIPVSWKCDGENDCDSGEDEENCGNVTCSPEEFTCSSGRCISKNFVCNGQDDCSD
GSDELDCAPPTCGAHEFQCSTSSCIPISWVCDDDADCSDQSDESLEQCGRQPVPHEKCPA
SEIQCGSGECIHMKWRCDGDPDCKDGSDEINCPSRTCRPDQFECEDGNCIHGSRQCNGVR
DCIDGTDELNCKNANQCSGPGKFKCRSGECIDISKVCNQQQDCKDWSDEPLKECNINECL
INNGGCSHICKDLIIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCEC
SRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTIALDADIAAQ
KLFWADLSQKAIFSATIDARDKVGRHVKMIDNVYNPAAIAVDWVYKNIYWTDVASKTISV
ATLDGTKRKILFNSDLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGLDRRPLVTVDI
QWPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLAVTIFEDRVYW
IDGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELIQPAGKNWCEEDTENGGCEYLC
LPAPQINDHSPKYACSCPNGYYLEGDGRACKRINVTTAISEVNASPGGTSAAWAILPVLL
LAMAATGGYFMWRNWQHKNMKSMNFDNPVYLKTTEEDLTIDIGRHSTSVGHTYPAISVVS
TDDDLA
Download sequence
Identical sequences G3VDK4
XP_012398385.1.9362 ENSSHAP00000001258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]