SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002259 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002259
Domain Number 1 Region: 146-222
Classification Level Classification E-value
Superfamily RING/U-box 1.72e-18
Family RING finger domain, C3HC4 0.036
Further Details:      
 
Domain Number 2 Region: 58-85
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000284
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002259   Gene: ENSSHAG00000002006   Transcript: ENSSHAT00000002283
Sequence length 238
Comment pep:known_by_projection scaffold:DEVIL7.0:GL842040.1:21763:23414:-1 gene:ENSSHAG00000002006 transcript:ENSSHAT00000002283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGTSKAIDDSSASISLAQFTKTANLAEANASEEDKIKAMMSQSGHEYDPINYMKKPLGPP
PPSYTCFRCGKPGHYIKNCPTNGDKIFESVPRIKKSTGIPRSFMMEVEDHTMKGAMLTNI
GKYAIPTIDAEAYAIGKKEKPLFLPEEPSSSSEEDGPIPDELLCLICKDIMTDAVVIPCC
GNSYCDECIRTALLESDEHTCPTCHQNDVSPDALIANKFLRQVSLFIYTIYTSILFCL
Download sequence
Identical sequences G3VGF5
ENSSHAP00000002259 ENSSHAP00000002259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]