SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002616 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002616
Domain Number 1 Region: 123-163
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000846
Family Retrovirus zinc finger-like domains 0.0016
Further Details:      
 
Domain Number 2 Region: 28-93
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00000897
Family Retrovirus capsid protein C-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002616   Gene: ENSSHAG00000002314   Transcript: ENSSHAT00000002644
Sequence length 187
Comment pep:novel scaffold:DEVIL7.0:GL835366.1:28474:29034:1 gene:ENSSHAG00000002314 transcript:ENSSHAT00000002644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRTFLIAASCALKAWGQVEASGPIHTRVTGLKQGPDKSVQDFVARVKTVCDRVISKGEGS
NTLFLKLREGLNKPCATATSTLGPEGSLQDIWDGYFSIDCAHLEIEALASAIAQGVAKGI
GNRQKNQGPCFSCNRMGHFQKQCRYPKGKRCFSCEKPGHFAKSAETRGRETGAPPPHTSQ
WTRNEPR
Download sequence
Identical sequences G3VHG2
ENSSHAP00000002616 ENSSHAP00000002616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]