SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002618 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002618
Domain Number 1 Region: 6-169
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 3.14e-20
Family Retrovirus capsid protein, N-terminal core domain 0.025
Further Details:      
 
Domain Number 2 Region: 183-249
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.000000000022
Family Retrovirus capsid protein C-terminal domain 0.0024
Further Details:      
 
Domain Number 3 Region: 328-369
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000563
Family Retroviral protease (retropepsin) 0.0037
Further Details:      
 
Domain Number 4 Region: 265-296
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000454
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002618   Gene: ENSSHAG00000002316   Transcript: ENSSHAT00000002646
Sequence length 369
Comment pep:novel scaffold:DEVIL7.0:GL835028.1:28499:30192:1 gene:ENSSHAG00000002316 transcript:ENSSHAT00000002646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASPQQQSPHPMTKLQKAVLKVTEEVQNTEMYPVIQQFNCSGQESRRYTHFDLEILKDLKK
AWTFDEATSSYVKMLLQNLSYEVLSPSDWKSIARTCLEPGQNLWFLNIVSCVGYKSNEIG
KRQTGVNTPITCDQLTGIDSYAETSAQINYPIAAYEQIAAAAAAAIKEWGFISGKQDRGE
AFTKKAQGPNESFADYVTAVIQTIGKNAATEIMTRQLAKENANENCTRLHKDAPLEEILR
QCATVGTNNFYSQAIMQTSQDPNMGRQGPFWQGTSRETCQCFQCGKVGHLKAQCSGSTEI
SSGDLKPVFLQPMDPLPPGTVGLAISLPETVTADRPMLTIYINGIALEGLVDTCADCTVL
SGTNWPSHW
Download sequence
Identical sequences G3VHG4
ENSSHAP00000002618 ENSSHAP00000002618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]