SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004457 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004457
Domain Number 1 Region: 185-221
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000005
Family Retrovirus zinc finger-like domains 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004457   Gene: ENSSHAG00000003920   Transcript: ENSSHAT00000004503
Sequence length 222
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834630.1:80434:81802:1 gene:ENSSHAG00000003920 transcript:ENSSHAT00000004503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGGGGEEEERKRGHGECQPPAPSESVEGEGRQGDAEELGKAGGSKEFDVSFRSAEKFDLF
LRKYQEKKGQDCWENFVLIQLTKPRLKTLFILFRNETVDTGDIVTWLKRHCDVLTTPVKV
ADRFGVWTGEYKCEIELWQGEEGISHLPGAFYLGAEKGYSWYKGQPKTCYRCGSKNHMSL
TCSQERCFRCGEQGHSTSFCKKGIVCNLCGQKGHIYANCPRA
Download sequence
Identical sequences G3VMQ2
ENSSHAP00000004457 ENSSHAP00000004457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]