SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000005410 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000005410
Domain Number 1 Region: 241-328
Classification Level Classification E-value
Superfamily RING/U-box 1.21e-20
Family RING finger domain, C3HC4 0.053
Further Details:      
 
Domain Number 2 Region: 153-179
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000471
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000005410   Gene: ENSSHAG00000004727   Transcript: ENSSHAT00000005464
Sequence length 1796
Comment pep:novel scaffold:DEVIL7.0:GL841550.1:118768:156208:1 gene:ENSSHAG00000004727 transcript:ENSSHAT00000005464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDD
NALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPVSGTSKAIDDSSASISLAQLTKTANL
AEANASEEDKIKAMMSQSGHEYDPINYMKKPLGPPPPSYTCFRCGKPGHYIKNCPTNGDK
NFESVPRIKKSTGIPRSFMMEVKDPNMKGAMLTNTGKYAIPTIDAEAYAIGKKEKPPFLP
EEPSSSSEEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCPTCH
QNDVSPDALIANKFLRQAVNNFKNETGYTKRLRKQIPPPPPPIPPPRPLIQRNLQPLMRP
PISRQQDPLMIPVTSASTHAATSISSSIPNQSSLSSAVPINQPSTPAPIPDITATVSISV
HSEKPDGPFRDPDNKIIPAAALVSDHPKASSSIAISALMEEKGYQVPVLGTPSLLGQSLL
HGQLIPTTGPVRINAARSAGGRPGWEPLENIKGYIVSTPKNIGNFTFCSQKSINRGRHHG
ERSQRTQGPSLPATPVFVPVPPPPLYPPPPHTLPLPPGVPPPQFPPQFPPGQPPPAGYSV
PPPGFPPAPANLSTPWVSTAVQTAHSNTIPTTQAPPLSREEFYREQRRLKEEEKKKSKLD
EFTNDFAKELMEYKKIQKERRRSFSRSKSPYSGSSYSRSSYTYSKSRSGSSRSRSYSRSF
SRSHSRSYSRSPPYPRRGRGKSRNYRSRSRSHGYHRSRSRSPPYRRYHSRSRSPPVFRGQ
SPNKRNIPQGETEREYFNRYREVPPPYDIKAYYGRNVDFRDPFEKERYREWERNYREWYE
KYYKGYAAGAQPRPPANRENFSPERFGPLGNRRENSPFARGRREDYSNVQGHRSRNIGGS
YPEKLSARDGHTMKDNAKSKEKESENPPGDGKGNKHKKHRKRRKGEENEGFPNTELLESS
RKQREPVGGEDIKTDSLFILPSRDDATPVRDEPMEAESITFKPVSEKEKKEKDKPKAKGD
KAKRKNEGTTSSKKESTAKPVKASQEKVDVEREKSPRSEPPSKKAKEEVPKTESTKSSSQ
KDEKTISTPRKAHPKMTKEHQETKSIKEEKAKKEYSKDAKQEKLANKEEKSKKTNEKSKP
ADAKPEKRKRKAEEKGVDKEHEILSLKNSKPEVAEMMKPSPKRKIEPDVEKTDRTPEKDK
TVLTAPAKKIKLNRETGKKIGSGENLPNAKELTEKLEPTSSKIKQEKVKGKVRRKVTTTE
GSSSTLVDYTSTSSTGGSPVRKSEEKTDTKRTVIKTMEEYNNDNTAPAEDVIIMIQVPQS
KWDKDDFESEEEDIKSTQAVSTVGKPASVIKNVSTKPSNPVKHIEKESEPSEKVQKPPKE
VSHEGIQHEAKSSKTCSSSEKGKTKDRDHSVSDKENSEKRKSSIQTEKDTSIDRINEQGN
FKSLSQSSKDTRTSDKHDSGRGSSSKDFTPNRDKKVDYDNRDHSGSKRRDERSDLTRRKD
SPSRTKTESSLGQKNKLKDERTDLPKKGVGESKRSNSSPSKDRRPYDHKVAHDSKRSNDD
NKSVDKNPVKEREKHISETKNNKEKELSGNKLFCRHSSPDTQIEKEHVTGQNDKIVVKPK
PQLSHSSRLSSDLTRETDEAAFVPDYNESDSESNVSAKEEETLGKNPKELKDKVAEKAKE
NLDTTVVAQIGVRSQSQSSPSVSRSRSHSPSGSQTRSHSSSASSAESQDSKKKKKKKEKK
KHKKHKKHKKHKKHTGTELELEKSQKHKHKKKKSKKSKDKEKEKEKDDQKVKSVTV
Download sequence
Identical sequences G3VQF5
ENSSHAP00000005410 ENSSHAP00000005410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]