SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009581 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009581
Domain Number 1 Region: 1132-1301
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 5.1e-47
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.01
Further Details:      
 
Domain Number 2 Region: 985-1129
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.92e-39
Family Poly(A) polymerase, PAP, N-terminal domain 0.033
Further Details:      
 
Domain Number 3 Region: 427-488,526-619
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.33e-35
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.065
Further Details:      
 
Domain Number 4 Region: 273-460
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.99e-26
Family Poly(A) polymerase, PAP, N-terminal domain 0.076
Further Details:      
 
Domain Number 5 Region: 1431-1462
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000106
Family Retrovirus zinc finger-like domains 0.0033
Further Details:      
 
Domain Number 6 Region: 1329-1358
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000167
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Domain Number 7 Region: 948-973
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000349
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009581   Gene: ENSSHAG00000008290   Transcript: ENSSHAT00000009665
Sequence length 1511
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841472.1:403969:489379:-1 gene:ENSSHAG00000008290 transcript:ENSSHAT00000009665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDAAKPCFFKRNKERGIIDDDFKRVSPQPDCLIMDDSGNGHSSKAEKGLPPKKGTPGNH
GNSPRKGPHAISSSPNAPKNMGHGQGGRINDSHKDKIRRWLTDELNETDNWLDFKTGSRI
SVMSRPRKDLFQESEDGHRWQDGRGSRSVRWQLQKDLTNIEISEMQTGSFENKKPKKPRK
SRRTRKEEHDQEEDMDGPVIDESVLSVKELLGLRQAEERLKRDCIDRLRKRSRNYPTAKY
ICKLCDVLVDSIASAHKHIKEKRHKKNIKEKHEEQLLTTLPPPTPSQIKAIGVAIDKVVE
EFGLNNEDLEQRLEIKQTMEKLFHQKLPDCSLRLYGSSYSRFGFKNSDLNIDVQFPATMT
QPDVLLLIQEILKSSESFIDIDADFHARVPVVVCREKQSGLICKVSAGNENACLTTNHLA
ALGKLEPKLVPLVIAFRYWAKLCCADHPEEGGLPSYVFALMAIFFLQQRKEPVLPVYLGS
WIDGFSLNKLVNFNLKEVENDLVVWEQITTRDDESSKETSFKRGKVPLVFDLENQCSAPV
GQLWVELLRFYALEFNLGDLVISIRAKEAISREAKDWPKKRIAVEDPYSVKRNVARTLNS
QLVYEYILHCLRATYKYFAILHKKAIKTTPKKPMNINIDASQTSKNLKDDVKHDPEVQVI
NNKIVVVSDYIDATNTAENFKAHQRNTIKVFDGFESPTEELGDVQVGINQGDLDCIIEEV
IFDDSEDFKPHYEETESGNDEDEEEEEEPDRQDWEKNLTTMDQELDDDSENGELLAHTND
LDMETDSISDLESFQNITITERDDFVTVDDKVDIDEESTEGTDELEDSNKVTHSVQGQTS
EIINSDDEEEDEEEARHTINERESVIVQGELDSYTGYGDEDALSEEDELIVPDKYEDLKE
VGKTVDEPLLMELNEKYPLMEENICEEDSALDHLDLFYEFSKPVFTKGKPPTVVCSLCKR
EGHLKKDCPEDFKKIELDPLPPLTPRFSNILDQVCIQCYKDFSATALEDQAREHIRQNLE
SFIRQEFPGTKLSLFGSSKNGFGFKQSDLDICMTIDGLETAEGLDCIRMIEELSRVLKKH
SGLRNVLPITTAKVPIVKFFHVRSGLEVDISLYNTLALHNTKLLAAYSAIDPRVKYLCYT
MKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQQRNPPVIPVLQEIYEEEKRPEIIVDGWN
TYFFDRISELPAFWPEHGKNTESVGELWLGLLRFYTEEFDFKEHVICIRRRSLLTTFKKQ
WTSKYIVIEDPFDLNHNLGAGLSRKMTNFIMKAFINGRRVFGIPVKGFPKEYPSKMEYFF
DPEVLTEGELAPNDRCCRICGKIGHFMKDCPMRRKVRRRHDHEDIKNQRYPENNEKRNKD
DKEIQNKSTEREMLVKEGKLQSTPQKNKQGRGVVLEMGRDKVSRQSLEKWKRQDEKDLRE
KRCFICGREGHIKKDCPQYKGATGVSKSDGVFGSPSPGPLKQTGKLNQAIHLHEEKKKQK
GKIFLSPQSGK
Download sequence
Identical sequences G3W2C6
ENSSHAP00000009581 ENSSHAP00000009581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]