SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011442 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011442
Domain Number 1 Region: 10-138
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 4.47e-28
Family Retrovirus capsid protein, N-terminal core domain 0.01
Further Details:      
 
Domain Number 2 Region: 147-220
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.23e-17
Family Retrovirus capsid protein C-terminal domain 0.0019
Further Details:      
 
Domain Number 3 Region: 275-321
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000278
Family Retroviral protease (retropepsin) 0.0072
Further Details:      
 
Domain Number 4 Region: 228-261
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000454
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011442   Gene: ENSSHAG00000009835   Transcript: ENSSHAT00000011538
Sequence length 322
Comment pep:novel scaffold:DEVIL7.0:GL849836.1:596382:597955:1 gene:ENSSHAG00000009835 transcript:ENSSHAT00000011538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVVEKLNSSGQERRRYTPFNLEIIKDLKKACILYEATSSYVKMLLQNLAYEILTPSDWKS
IARTCLGPGQNLLWLSEHSELCRIQIQQNKQTGVNTPITYDQLTGVSSYADISAQINYPI
AAFQEIASAAIEAWGFLPGNKTDEKPSKIEQGPNEPFADFVGPLQTAIGENAAKEIMIRQ
LAKENANEVCRRIILGLCKDAPLEEIIRRCATVGTNTFYAQAMMQTSQDPNQGTSRETRQ
CFQCGKVGHLKGQCWHKDRAQQSGDNHPDSDSKQQNPGIFWTAAVTADCPMLIIYINGIP
LEGLLDTGADHTVIRGANWPSH
Download sequence
Identical sequences G3W7N7
ENSSHAP00000011442 ENSSHAP00000011442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]