SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012051 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012051
Domain Number 1 Region: 549-604,690-855
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.19e-37
Family Tandem AAA-ATPase domain 0.00022
Further Details:      
 
Domain Number 2 Region: 414-445
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000314
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012051   Gene: ENSSHAG00000010333   Transcript: ENSSHAT00000012149
Sequence length 1243
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841407.1:669283:700267:-1 gene:ENSSHAG00000010333 transcript:ENSSHAT00000012149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERCREVRALLKAWEMAFLQEHKRKPNKNDVESAPEEMKELYREYRALRRDQESAGLPQP
SSLGQKDAAAEQAPELGCWGAHLNRKGTKPPPPTQMAPLRVPSKCYGSTLKANLKADLQA
GPRLGRIPRLPRRQQPEKCPSPKSRLSVPSAPTEAMPDPCEENTARLEPPVSPWGFGPRP
VPQPGKLKHLQHTLGQRLSSLDPDWLQRCQVETREKLGRIEHSSLLSSPPGSPAETQNPY
PEQEKGIELLNGRNLKSAPQGDAISSSPLPSETLETRPLCGSPPGKEETPSTSKVRTLQR
NPTQKRKRGGSQDRPPKQQKTGAKRLGTEPSGEQSKESEKVAALDNPEEDLLGEIVAQTA
KTGTRARAPPRTFSKATGNFVRLNLKKKCYVKGFGLRGNRLRKQIWKKKWQMKSEQFGGG
WSRDQGKDLCFRCGAAGHWASQCRATALPCHQPAKEESSETLEEQEEDEEPPLSTLQEVA
QRASSTSCQGPGSEERSRPVSPRGAVSPRGPVPEPPALPPAVEPLYGLGPSGQLAETPSE
VFAALTQFGHRTFRPGQEAAIMRILSGLSTLVVLPTGMGKSLCYQLPALLYARRSRCVTL
VVSPLVSLMDDQVSGLPRGLRAVCIHSNMTRKQREAAMEKVLRERLGVRSFLGLTATATR
ATARDVGQHLGIPEGAICGTHSASIPPNLHLSVSLDRDKDQALVTLLQGERFRTLGSIIV
YCNRRDETVRVAALIRTCLQESPNLGRSEESPGPRGLLPEAVAEAYHAGLPASERRRVQR
AFMKGRLRVVVATVAFGMGLDRPDVRAVLHHGLPGSIESYVQEIGRAGRDGLPAHCHLFL
QPQGEDLRELRRHIYTDTVDYLTLKKLVQRVFPPCTCSSLLQQLQVLNEEVLQEQSPSLH
RQEKQEVPSSGGGDAQEESELAASVQRACPGHERALSVQQMVEALDMREEAIETLLCYLE
LHPKNWLKLLAPTFATCHLKCYGGPPELQAVAKRCPPVAVSLTRQQAAKTKGRSSLEFNV
VELADSMGWEAALVRRTLNQLQWEAAPGTRARRRTGVLVEFGDLSFHMQSPGDLTAFEKD
EICDFLYQRIQTREREALTQLRATFQAFQRVAFPNCGPCMEHADEERSDQLKSLLTRYFE
EGTAALWEGEFREDSEQDHDFGQARLQDWESSVCSDIRQLLSIRQEEKFSGRAVARIFHG
IGSPRYPAEVYGQDRRFWRKYLHVSFPSLLCLATREILAWKRT
Download sequence
Identical sequences G3W9E6
ENSSHAP00000012051 ENSSHAP00000012051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]