SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000015322 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000015322
Domain Number 1 Region: 59-197
Classification Level Classification E-value
Superfamily dUTPase-like 1.96e-49
Family dUTPase-like 0.000000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000015322   Gene: ENSSHAG00000013061   Transcript: ENSSHAT00000015449
Sequence length 198
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834501.1:1156146:1170525:1 gene:ENSSHAG00000013061 transcript:ENSSHAT00000015449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAVSRACRTTSRRGPLGRPSALLHASHREMPCSEAVPAGVSPSKRARPAEQEPEGPVRL
RFARLSEHATAPSKGSARAAGYDLYSAYDYTIPAMEKALVKTDIQISLPPGCYGRVAPRS
GLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKETFEVKKGDRIAQLICERVFYPELEEVQ
GLDDTERGAGGFGSTGQN
Download sequence
Identical sequences G3WIR7
ENSSHAP00000015322 ENSSHAP00000015322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]