SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000015960 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000015960
Domain Number 1 Region: 37-70
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000109
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000015960   Gene: ENSSHAG00000013590   Transcript: ENSSHAT00000016091
Sequence length 196
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834580.1:1269408:1282247:-1 gene:ENSSHAG00000013590 transcript:ENSSHAT00000016091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVVFCFHRGETSQNASRWSPVLTKMATPMHRLIARRQAEANKQHVRCQKCLEFGHWTY
ECTGKRKYLHRPSRTAELKKALKEKENRFLLQQSIGETNTEKKTKKKRSKSVTSSSSSSS
ESSASDSSSESEDSSSSSSSDDSDTEESSSTSSSSHSSTSSSSSSDSESDSSSSSSTSSS
TDSSSDDEPPKKKKKK
Download sequence
Identical sequences G3WKK5
XP_003756535.2.9362 ENSSHAP00000015960 ENSSHAP00000015960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]