SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000017113 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000017113
Domain Number 1 Region: 230-277
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000314
Family Retrovirus zinc finger-like domains 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000017113   Gene: ENSSHAG00000014544   Transcript: ENSSHAT00000017255
Sequence length 541
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841484.1:1513576:1776658:1 gene:ENSSHAG00000014544 transcript:ENSSHAT00000017255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGGFENIEAYEDDLYRDESSSELSVDSEVEFQLYGQVHYAQDLGDVTREEENEEKRSED
PESLNIKKTNQKNLIVLSDTDVIQISDGSEVISLSDEDSIYRCKRKNRGNQVLENQCDQH
SDELSRKKCKRGNKSKHGERSNVIQEVMVIEDSSNEEKITISESGESDVESWMLLECEVD
DKDDNILLNLVGCETSVDEDKSDVNWFISDKDLEAQISNNRSSGKRTNRYYSADKNVTCR
NCEKRGHLSKNCPVPQKIRVCCLCAERGHIQYDCPARFCLDCFLPACYSHKCLERPSWKK
HCERCDMKGHYADTCPEIWRQYHLTTKPGPPKRPKTYFGRSALVYCYNCSRKGHYGYECT
ERRMLSGTFPTVPFIYYYDKEHDIRDHEQRIQWKVEELQKNGELPRPVKRPHLESTSRSH
YHGIKKRYTVQEDYKWHQEKKYLRRTKMSNWSNRSQEKKSRRDVQRWYDADEDFIRGPRS
HSSSHRSSHLGYHHQKMSGGELSKRAKWEKYKKRERKRADDEEGLFLIKQRKRKSKMKNN
C
Download sequence
Identical sequences G3WNV8
ENSSHAP00000017113 XP_012398137.1.9362 XP_012398138.1.9362 ENSSHAP00000017113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]