SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018817 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018817
Domain Number 1 Region: 12-101
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.61e-24
Family Canonical RBD 0.0021
Further Details:      
 
Domain Number 2 Region: 92-129
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000645
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018817   Gene: ENSSHAG00000015970   Transcript: ENSSHAT00000018972
Sequence length 139
Comment pep:novel scaffold:DEVIL7.0:GL834746.1:1972774:1974192:1 gene:ENSSHAG00000015970 transcript:ENSSHAT00000018972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNAVFFCSLTETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPR
DAEDAVRGLDGKVICGSRVRVELSTGMPRRSRYDRPPARRPFDPNDRCYECGEKGHYAYD
CHRYSRRRRSRFLRLSQSP
Download sequence
Identical sequences G3WTR2
ENSSHAP00000018817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]