SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020146 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020146
Domain Number 1 Region: 1-95
Classification Level Classification E-value
Superfamily PX domain 0.0000000000121
Family PX domain 0.0033
Further Details:      
 
Domain Number 2 Region: 179-233
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000181
Family SAM (sterile alpha motif) domain 0.0052
Further Details:      
 
Domain Number 3 Region: 781-813
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000262
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020146   Gene: ENSSHAG00000017090   Transcript: ENSSHAT00000020306
Sequence length 837
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834766.1:2500559:2515599:-1 gene:ENSSHAG00000017090 transcript:ENSSHAT00000020306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLWSDSSITSLTKSSTEVTEFISKLSQLYPEENLEKFIPCLSGPDSFYLERNHMDLESDL
RYLASLPSHILKNDHVKKFFSTSTPTQQLQSPSPGTPSLSKVGTMMGASGRPICGVAGIQ
SSQNSTQHHIQHSASAAVALPHCSHSGSTGSSLTYRTQMDTSSPILMSSSLQTPQTQEQN
GILDWLRKLRLHKYYPVFKQLTMEKFLSLTEEDLNKFESLTMGAKKKLKTQLELEKEKSE
KRCLNPSTPSSVTNSGVARVPPTSHVGPIQTIRGNHAAELRVDVEQPAHQMPREGSSSEY
SSSSSSPMGIQAREESSDSAEENERRLEIHLEGSDKEKPVMLLNHFTSSSARPTAQVLPV
QNDAGSNPSGHHPLPAQMMTAAASHIAPIRMLNSVHKSERGNTDMKLLSSSMHSLLSLEE
RNKVASGPRGSIKVEKSFGNTMMEVLPASSPHQPMQVLSGIPESSSVSPTVSFGPRTKVV
HASTLDRVIKTAQQPALVVETSTAATVTSSTVFHVARPPIKLLVSSSVPADSAISGQTSC
SNNVQISVPPAIINPRTALYTANTKVAFSAMSSMPVAPMQGSFCANGNTASSNSHPSTSF
ANMANMTSCPAPSSSPTLSSVTENNFYSSSSSSSNSSSGSTGTIPVPNQNHHHHHHHQQQ
QQQQPPQQQQPPGCIVCTSCGCSGNCGSSGMTVSYANYFQHPFSGPSMFTFPFLPFNPLC
SNGYINTQQYSSGTTFPVVHSPYNSNLTPDSVLSGQSTFAVPPMQNFMAGTAGVYQAQGM
MGNNSSGHKKSGNLSCYNCGATGHRAQDCKQPPMDFNRQGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences G3WXJ1
ENSSHAP00000020146 ENSSHAP00000020146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]