SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020456 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020456
Domain Number 1 Region: 29-104
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.21e-16
Family Retrovirus capsid protein C-terminal domain 0.0025
Further Details:      
 
Domain Number 2 Region: 119-174
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000164
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020456   Gene: ENSSHAG00000017345   Transcript: ENSSHAT00000020619
Sequence length 208
Comment pep:novel scaffold:DEVIL7.0:GL834507.1:2653694:2654409:1 gene:ENSSHAG00000017345 transcript:ENSSHAT00000020619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YIIAAYEQIVTAAIKAWGSLPGKNRGEVFTKIEQGPNKFFADFMGHLQIAVKRTIGENAA
TRIITRQLAKENANKVCRRIIWGLHKDAPLEEIIRNCATVSTNAYYTQTMMDMGRQGPSW
QGTSRCFQFGKIGHLRAQCKNSNRVKKQGERRTSKTLCRKCNRGFHWASECRLTQGNKGQ
GPTPKPQTKNRRKGLHDQSAKKQLYGRK
Download sequence
Identical sequences G3WYF1
ENSSHAP00000020456 ENSSHAP00000020456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]