SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000003063 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000003063
Domain Number 1 Region: 130-260
Classification Level Classification E-value
Superfamily E set domains 1.05e-49
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000045
Further Details:      
 
Domain Number 2 Region: 1-135
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.9e-46
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000003063   Gene: ENSSHAG00000002714   Transcript: ENSSHAT00000003099
Sequence length 483
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864913.1:39499:48702:1 gene:ENSSHAG00000002714 transcript:ENSSHAT00000003099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QINGYTGPGTVRISLVTKEPPHRPHPHELVGKDCRDGFYEADLCPDHCIHSFQNLGIQCV
KKRDLEQAIAHRMQTNNNPFNVPLEEQRGDYDLNAVRLCFQVTIRDAAGRPLVLPPVLSH
PIYDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVCFTGQGWEARGSFSQ
ADVHRQVAIVFRTPPYAEPALAAPVRVHMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEK
RKRTLGTFKNIMKTSPFTGNSDAWAPPRRIAVPSRSSTASAAKPPGKGPSDRPGFSGSRS
GGVGGHPWAVGSRPGGRTQPLSLISVSLAPHRCPXPTAPSLGPAPAPAAPAPALPQLPQS
GEGMLSDAMLGLQFDTDGDLTELLGDPDGTYANLAAIDNSEFQQLLNQGIAGSLEGPGPS
GEPMLMEYPESITRLMTGPQRPPEPGPAPSGPSGLANGLLGADEVFPSVGDMDLQAFLSQ
ISS
Download sequence
Identical sequences G3VIQ9
ENSSHAP00000003063 ENSSHAP00000003063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]