SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000003909 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000003909
Domain Number 1 Region: 144-277
Classification Level Classification E-value
Superfamily E set domains 5.83e-48
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000228
Further Details:      
 
Domain Number 2 Region: 3-149
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.86e-41
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000003909   Gene: ENSSHAG00000003442   Transcript: ENSSHAT00000003948
Sequence length 416
Comment pep:known_by_projection scaffold:DEVIL7.0:GL850001.1:63494:81293:1 gene:ENSSHAG00000003442 transcript:ENSSHAT00000003948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XTEASKTLPAIELRDCGGIREVEVTACLVWKDWPHRVHPHGLVGKDCADGVCRVRLRPHI
SPRHSFNNLGIQCVRKREIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFLASYRD
AQGQLRRLEPVLSDPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVV
FSTASWEGRADFSQADVHRQIAIVFKTPPYEDLSIPEPVTVNVFLQRLTDGVCSEPLPFT
YLPLDHDSYGVDKKRKRGMPDVLGELSSSDPHGIESKRRKKKLGYLDHFSPTSSAALPFL
PPASLMPEPDFLPPVTLPGLEPPGEPDPMDNYGYPYEQSSNIFTMLDLFPGPGLGGSAEG
SAPPEPHSPELLTLDSYPASGFEGTASLVGSNMFPNQYREGAFGGGSLLPPGPEAT
Download sequence
Identical sequences G3VL54
ENSSHAP00000003909 ENSSHAP00000003909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]