SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004082 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004082
Domain Number 1 Region: 565-1035
Classification Level Classification E-value
Superfamily Ras GEF 6.8e-133
Family Ras GEF 0.000000000000505
Further Details:      
 
Domain Number 2 Region: 7-177
Classification Level Classification E-value
Superfamily Histone-fold 3.53e-51
Family TBP-associated factors, TAFs 0.00000038
Further Details:      
 
Domain Number 3 Region: 200-395
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.29e-40
Family DBL homology domain (DH-domain) 0.0000000901
Further Details:      
 
Domain Number 4 Region: 416-572
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-36
Family Pleckstrin-homology domain (PH domain) 0.00000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004082   Gene: ENSSHAG00000003599   Transcript: ENSSHAT00000004123
Sequence length 1329
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834555.1:68425:180726:1 gene:ENSSHAG00000003599 transcript:ENSSHAT00000004123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPQQPYDFFSEENHPKWRGLFIPALRKVQHQVHPNLSAKEDCLYYIEELILQLLHKLC
IVQPRTVQDVEERVQKTFPHPIDKWAIADAQSAVEKRKRRTPLLLPVDKIHPLLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDESLSSGELNYYDIVRTEIAEERQYLRELNLIIKVFREAFLSNKKLFASSDI
EGIFSNILDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPQFHEHFNTLMAKPAVSLHFQSIADGFKEAVQYVLPRLMLVPVYHCSHYFELLEQLQE
CSEEQEDRECLKQAITALLNFRCSMERICNKHSPRRRPVDPVCRFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIVQCCNEFIMEGPLIRIGAKHERHIFLFDGLMISCKTNHGQSRIPG
YSNAEYRLKEKFIMRKIQICDKEDTSEYKHIFELISKDENSIIFAAKSTEEKNNWMAALI
SLQYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSGIPVIKGG
TVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLKLLIERFEIPEPEPSEADKLAVE
KGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLQLLEKLESFISSVKGK
TMKKWVESIVKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQYETFDLMTLHPIEI
ARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEAEN
FEERVAVLSRIMEILQVFQDLNNFSGVLEIVSAMNSVSVYRLEHTFEALQERKRKILEEA
VELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKQGKELINFSKRRKV
AEITGEIQQYQNQPYCLRIEAEIRRFFENLNPIGNASEKEFTDYLFNKSQEIEPRNCKQP
PRFPRKTTFSLKSPGIRPHTGRHGSTSGTLRGHPTPLEREPCKISFSRINEAEHESTASA
PTSPNTPSTPPVSASSDLSVFLDTDLNTSYGSNSIFAPVILPPSKSFLNSCGSLHKLTEE
SLVPPPLPPRKKFDQDVSTSKGNVKYDDDPPAIPPRQPPPPKIKPRVPAYSGPFEGPLPS
PPPPPPRDPLPETPLPVPLRPPEHFINYPFNLQPSPMGHTHRDPDWFREASTCPNSPNTP
PSTPSPRVPHRCVLSSNQNNLAHSQAPPIPPRQNSSPHLPKLPPKTYKRDLCQPPVYRLP
LLEHAETPQ
Download sequence
Identical sequences G3VLM7
ENSSHAP00000004082 ENSSHAP00000004082 XP_003756452.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]