SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004672 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004672
Domain Number 1 Region: 642-897
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-56
Family YWTD domain 0.00000464
Further Details:      
 
Domain Number 2 Region: 30-290
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-55
Family YWTD domain 0.00000215
Further Details:      
 
Domain Number 3 Region: 341-580
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-50
Family YWTD domain 0.00000215
Further Details:      
 
Domain Number 4 Region: 944-1199
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-39
Family YWTD domain 0.0000686
Further Details:      
 
Domain Number 5 Region: 1330-1366
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1292-1327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 7 Region: 1251-1291
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000903
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 900-951
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000559
Family EGF-type module 0.023
Further Details:      
 
Domain Number 9 Region: 597-643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000209
Family EGF-type module 0.012
Further Details:      
 
Domain Number 10 Region: 295-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000484
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1210-1261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000865
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004672   Gene: ENSSHAG00000004102   Transcript: ENSSHAT00000004720
Sequence length 1610
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864915.1:88713:171980:-1 gene:ENSSHAG00000004102 transcript:ENSSHAT00000004720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RREAPPSPPWPRAVLMLPLCPCRCPLAASPLLLFANRRDVRLVDAGGAKLESNIVVSGLE
DAAAVDFQFSQGVIYWTDVSEEAIKQTYFNQSGSAVQNVIISGLVSPDGLACDWIGKKLY
WTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDS
STRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFAL
TLSGDTLYWTDWQTRSIHACNKRTGEKRREILGALYSPMDIQVLSQDRQPYFHTPCEEDN
GGCSHLCLLSPREPFYTCACPTGVQLEDNGKTCKAGAEEVLLLARRTDLRRISLDTPDFT
DIILQIDDIRHAIAIDYDPVERYVYWTDDEVRAIRRAYLDGSGAQTLVSTEINDPDGIAV
DWVARNLYWTDTGTDRIEVTRLNGTSRKILISENLDEPRAIVLNPVMGYMYWTDWGESPK
IECAHLDGQARRVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTRRRTLLED
KLPHIFGFTLLGDYIYWTDWQRRSIERVHKVKADRDVIIDQLPDLMGLKAVNVAKVIGTN
PCGEKNGGCSHLCFFTPHATKCGCPIGLELLSDLQTCIIPEAFLVFTSRAAIHRISLETN
NNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAYMNGSSVEHVIQFGLDYPEGM
AVDWMGRNLYWADTGTNRIEVARLDGQYRQVLVWKDLDNPRSLALDPTKGYLYWTEWGGK
PRIVRAYMDGTNSITLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERIIIAD
DLPHPFGLTQYSDYIYWTDWNLHSIERANKLTGKNRTLIQGHLDFVMDILVFHSSRQDGL
NDCVQNNGHCGQLCLAVPNGYRCACATHYSLDPNHRNCSSPTTFLLFSQKCAISRMIPDD
QQSPDVVLPLHGLRNVRAIDYDPLDKFIYWVDGRQNIKRARDDGSQPFIVTSASQGQEKQ
PHDLSIDVYSHTLYWTCEATNTVNVHRLSGEAIGVVLRGDRDRPRAIAVNAERGYMYFTN
MQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNHLGKLFWVDADLKRIESCDLSGAN
RVTLEDSNIVQPVGLTVLGDHLYWIDRQQQMIERVEKTGGYKRTRIQGRISHLTGIHAVE
EVDMEEFAAHPCSRDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFT
CATGEIDCIPMAWRCDGFPECDDHSDEADCPVCSAAQFQCEKGQCIDLRWRCNGEIDCQD
KSDEADCDAICLPNQFRCASGQCILIKQQCDSFPDCMDGSDELLCEITKPPSDDPPSHSN
AIGPVIGIILSLFVMGGMYFVCQRVICQRYTGASGPFPHEYVSGAPHVPLNFIAPGSSQH
GTFTGISCGKSMISSMSLMGGSSGLPLYDRNHVTGASSSSSSSTKATLYPQILNPPPSPA
TDRSLYNTEMFYSSNIPSTTRSYRPYIIRGIAPPTTPCSTDVCDSDCTTSRWKASKYYMD
LNSDSDPYPPPPTPHSQYLSAEESCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences G3VNB7
ENSSHAP00000004672 ENSSHAP00000004672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]