SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014223 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014223
Domain Number 1 Region: 885-979
Classification Level Classification E-value
Superfamily Fibronectin type III 3.26e-19
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 2 Region: 72-169
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000116
Family Fibronectin type III 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014223   Gene: ENSSHAG00000012159   Transcript: ENSSHAT00000014341
Sequence length 1122
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849566.1:979197:1246755:1 gene:ENSSHAG00000012159 transcript:ENSSHAT00000014341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFLRPDPNTKLEGFLLGYGSNSHSNQYFPLPAEGKSSQAEVDAEPKYLIVVRPVPPPSQ
KKKCSGKSRTRQPLQMVVGTLSPSSVFLSWGFLINPQYDWTLPSQCPNDRLYTVRYREKD
KEKKWIFQICPATETVVENLKPNTIYEFGVKDNLEGGLWSRIFNHKTVVGTKNKGNGKIQ
STYDQTHIVPAYIPKKIIPITIIKQVIQNVTHRAASKSPDRPSVGGTILVHLIIPGLNET
TPKGSPPIMLDISETVKTLLAKNETLAIPVESKIPEEGKIPAQPVPVTMETVQRTTSPTM
TSVIEISETTLVQSEKNEEMFKSFMIYNIFILYLITAPNKLPEFPQAKTPFSLAKPRATL
ASDQIQWIVPTAKTSDGLKVLQPHPATHDMQPVLSSTPTTDEPEISITQTAATTTLDSAP
SKTSRTIEQPRATLAPNEVPLLPQKPKIYASPEIQHTTLASTQTTSIPSTPKRQSTPKPK
PTSHGLKRPTATLASALPKTKRPGHRRRPKTTPSPKASLTQSALEPATLRTVTPAATLAS
IETTPVPSKTLALPKPDAPQTKTAPKKTTHAPPKMKTTPASVKPGKSTKVSRPVTSKPKI
SPRPHASSTLPAPKDVHKPDSDVSQTKPAPIGTKSIPVKPKISPSPSQDVLQTTLAKTVH
STQEPATTKIPRKPKRTKTTQAPNKVYTTTIRKRPVRPDKNRTIAGADRFKPNGISQDTD
YIKPSSGDINKHISAPKNVSLDATKKPGTVAKTHHPILPPPKPTRRKLQPQNVTGKPGST
GTILLPRVTSPPPKVTVKPTGPTMPKKIETEKKQPTASVTGEYGNLTDFSSSPTRETDSL
GNQRFVAPHVRYIPKPENEPCSITDSMKRFPTEEVSEESPTSPPQNPPTNLTVVTVEGCS
SFVILDWEKPQNDTVTEYEIRSKENGAPTGKKESIQTTNQTFSTIENLKPNTSYEFQVTP
RNPLGEGPPSTTVSFSTESADPRVSEPISAGRDAIWTEIPFKSDSYSECKGKQYVKRTWY
KKFVGVQLCNSLRYKIYLSDSLTGKFYNIGDQRGHGEDHCQFVDSFLDGRTGQQLNSDQL
PIKEGYFRAVRQEPVQFGEIGGYTQINYVQWYECGTTIPGKW
Download sequence
Identical sequences G3WFL8
ENSSHAP00000014223 ENSSHAP00000014223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]