SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000015895 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000015895
Domain Number 1 Region: 50-137
Classification Level Classification E-value
Superfamily TAFH domain-like 1.23e-28
Family TAFH domain-like 0.000005
Further Details:      
 
Domain Number 2 Region: 329-376
Classification Level Classification E-value
Superfamily Histone-fold 4.14e-17
Family TBP-associated factors, TAFs 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000015895   Gene: ENSSHAG00000013545   Transcript: ENSSHAT00000016025
Sequence length 541
Comment pep:novel scaffold:DEVIL7.0:GL834521.1:1258335:1260013:-1 gene:ENSSHAG00000013545 transcript:ENSSHAT00000016025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QESQAQTTVQPTTTLQHSPVVQPQIVLGSTAQPRTPQRTVQQGTTATSAAATETMENVKK
CKNFLTLIKLASSGKQSTETAANVKELVQNLLDGKIEAEDFTKLNSSPQPYLVPFLKRSL
PALRQLTPDSAAFIQQSQQQQPPTQATTALTAVVLSSSIQCTAGKTAATVTSTLQPPVIS
LTQPTPVTVSKQGQPTPLVIQQPQKPGALIRPPQVILTQTPMVALRQPHNCIMLTTPQQI
QLNQPQTVPVIKPAVLPGTKALSTILAQAAAAQKNKPKEPGGGSFRDDDDINDVASMAGV
NLSEESARILATNSELVGTLTRSCKGETFLLSAPLQRRILEIGKKHGITELHPDVVSYVS
HATQQRLQNLIEKVSETAQQKNLSYKDDERYEQASDVRAQLKFFEQLDQIDKQRKDNKRE
ILMRAAKSLSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKMDSPG
PGSGTEGSGTSIAVPGSSGVGTTRQFMRQRITQVNLRDLIFCLENEPETSHSRLLYKAFL
K
Download sequence
Identical sequences G3WKE0
ENSSHAP00000015895 ENSSHAP00000015895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]