SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016431 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016431
Domain Number 1 Region: 632-887
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-57
Family YWTD domain 0.00000295
Further Details:      
 
Domain Number 2 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 1.24e-55
Family YWTD domain 0.00000134
Further Details:      
 
Domain Number 3 Region: 331-570
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-49
Family YWTD domain 0.00000389
Further Details:      
 
Domain Number 4 Region: 935-1194
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-39
Family YWTD domain 0.0000369
Further Details:      
 
Domain Number 5 Region: 889-937
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000126
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 1325-1363
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000864
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 587-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000126
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 8 Region: 1246-1286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000013
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1287-1323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 283-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000778
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1204-1257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000306
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016431   Gene: ENSSHAG00000013979   Transcript: ENSSHAT00000016568
Sequence length 1613
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861614.1:1365177:1498150:1 gene:ENSSHAG00000013979 transcript:ENSSHAT00000016568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAVLRSLLACSFCVLLRGAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVF
DHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGTLRKVLFWQELDQPRAIALDPANGFMYWTDWGEVPKIERAGMDGSNRFIIINTD
IYWPNGLTLDYEEEKLYWADAKLNFIHKSNLDGTNRQAVVRGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGEGLREVHSDIFSPMDIHAFNQQRQPNATNPCGIDNGGCSHLCLMS
PIKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPLEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEEKIYWGDAKTDKIEVMNADGTGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPCANENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSSLEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNTDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGLTVVVSSVPNQNVDMQPYDLS
IDIYSRYIYWTCEATNVINVTRLDGRPVGVVLKGEQDRPRAIMVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDRQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLL
EYRQHPCSQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGE
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGVLRCNGDANCQDKSDEK
NCEVLCLIDQFRCTNGQCIGKHKKCDNNVDCSDKSDELDCYPTEEPTPQATNTVGSVIGV
ILTIFLFGAMYFICQRVFCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPGILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRITTVAAAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences G3WLX6
ENSSHAP00000016431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]