SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016937 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016937
Domain Number 1 Region: 13-196
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.8e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000488
Further Details:      
 
Domain Number 2 Region: 191-309
Classification Level Classification E-value
Superfamily E set domains 5.6e-44
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016937   Gene: ENSSHAG00000014405   Transcript: ENSSHAT00000017079
Sequence length 601
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834732.1:1475322:1530715:-1 gene:ENSSHAG00000014405 transcript:ENSSHAT00000017079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTAAPAELGGHEPYVEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMN
CYGKGKGKVRITLVTKNEPYKPHPHDLVGKDCKDGYYEAEFGQERRALIFQNLGIRCVKK
KEVKEAIVSRISAEINPFNVPEQELLNIEDCDLNVVRLCFQVFLLDEHGNLTSALPPVVS
NPIYDNRAPNTAELRICRVNKNCGSVKGGDEIFLLCDKVQKDDIEVRFALNEWEAKGSFS
QADVHRQVAIVFRTPPFYKEITEPITVKMQLRRPSDQEVSESMDFRYLPDEKDPYGNKSK
KQKTTLDLQKLLQVIVSFPERSKAGPPRSTGEMRIIKKGNLSSSKIIKKEMSRTPGAMHQ
VPSYFPSSFVSSSNTMSHPASTLSSMGTYPSSSWPSMTLPTSINSINTHSPNGFPTGTLS
SGSQNSRSYLETANISSSLDTSDPCLFNNGTDGIGAQSLAQADLFSVNTSMLPNRPMNIT
TPNSDSMMETETPFVSMNLESSSYNSVLTPRDYRRPLHLTSSARVSAVGSSTSPPLLVPQ
ADMFDAVDFTCLENSTVSESKSSGNPNSNNPSFMPNSQCYINDNMQSEDHFNSFEVNFFH
L
Download sequence
Identical sequences G3WND2
ENSSHAP00000016937 ENSSHAP00000016937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]