SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019347 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019347
Domain Number 1 Region: 572-756
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.02e-53
Family DBL homology domain (DH-domain) 0.00000011
Further Details:      
 
Domain Number 2 Region: 760-895
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-38
Family Pleckstrin-homology domain (PH domain) 0.00000124
Further Details:      
 
Domain Number 3 Region: 281-399
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000141
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 4 Region: 71-167
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000103
Family CRAL/TRIO domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019347   Gene: ENSSHAG00000016433   Transcript: ENSSHAT00000019503
Sequence length 910
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849905.1:2168167:2423121:-1 gene:ENSSHAG00000016433 transcript:ENSSHAT00000019503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQEIRPLAAVDIIEQLHRQFAILSGGRGKDGAPIITFPEFAGFSEIPDEDFLNVVTYLT
SIPSLEAASIGFIIVIDRRRDKWSSVRASLTRIAGAFPGNLQLVFVLRPSRFIQRTIADI
GIKLYRDDFKMKVPIIMLNSVSDLHGYIDKSQLTRELGGTLEYGHGQWIHHRTAIENFAL
TVKTTAQMLQTFGTDLAETELPNDVQCTEQLLQSHTEQHSKLKAELKLAGSQGGTLLSCI
REPASKNPTSKLNPDELENVLTVERLLAQLDETEKAFDQFWTKHYLKLNQCLQLRHFEHN
FREVKLALDSLMCVQARFTVIGNSVARVEQLLKERKHLEEKGQEPLEKAQSLAVTGDQLI
QSNHYAVDSIRPKCVELRRICDDFSNEAKKKCDILGKALEMHKQLDATSKWCEAGIYLLA
SQALDKCQTQEGAETALGDIEKFLSTVTEHQLVNPKEFYSQFNLVLTPEIKENADKIVQK
LEDVQEMFERRQVSLKKLAAKQTRPVQPVAPHPESSPKRASPKTNRPTNLVNKSSRKNAL
PRGPRRRVKSLTQVPREGRTNSSLKPDWRNSVLCYHIMHELIETERVYVEELQSIIEGYA
AEMDNPDLNHLIPVALQNKKEILFGNLPEIHEFHNRIFLKELENCVENPEFLGRCFLKRK
EDLQVYEKYCQNKPRSETLWRQCGDSIFFQECQRKLDHKLSLDAYLLKPVQRITKYQLLL
KEMLKCSKNSEDTAELEEALATVLDIIKSVNDSMHQIAITGYEGDLHELGKLLMQGSFSV
WTDHKKGHNKVKDLARFKPMQRHLFLYAKILLFCKKREDTADGHEKSPSYSFKHSLKMSM
VGITENVKGDNKKFEIWYNGREEVYIIQASSVELKNLWVSEIRKVLTGQLEACRGREALP
DSPLSPHPTP
Download sequence
Identical sequences G3WV92
ENSSHAP00000019347 ENSSHAP00000019347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]