SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020370 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020370
Domain Number 1 Region: 499-687
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.63e-53
Family DBL homology domain (DH-domain) 0.0000000101
Further Details:      
 
Domain Number 2 Region: 692-832
Classification Level Classification E-value
Superfamily PH domain-like 8.13e-38
Family Pleckstrin-homology domain (PH domain) 0.000000158
Further Details:      
 
Domain Number 3 Region: 191-329
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-17
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 4 Region: 988-1042
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000278
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020370   Gene: ENSSHAG00000017277   Transcript: ENSSHAT00000020531
Sequence length 1086
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849842.1:2611956:2670290:-1 gene:ENSSHAG00000017277 transcript:ENSSHAT00000020531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSCFSLQDTGIGFILVIDRRQDKWTSVKASVLRIAVSSKRFLKVLLVLKVPVIFFSCRA
FYFFDTSTAVVYSSTLAQQDSYIVRLIEKKNQTLNYCTISLSLFQKAIESFALMVKQTAQ
MLQSFGTELAETELPNDVQSTNSILSAHTEKKGKMKEDMMLALKEGHTILESIREPLAKN
PEYNLNQDQLDNQTTVQRLLDHLGETEAAFDEFWAKHQQKLEQCLQLRNFEQNFREVKAI
LDVVSERLSAFTDVGNSYAHVEHMLKDLTSFEEKSNEAVEKARALSLEGNQLIQSKHYAV
DSISPKCNELQHLCDEFTAEMSKRRNLLHQSLELHCLLEKSMKWCDEGIYLLASQPVDRC
QSQDGAESALQEIEKFLDTGAKNKIQELNKVYKEYEPILNPDLKEHVQKVFQKQESMEEM
FQKRQVSLKKLAAKQTRPVQPVAPRPEAFTKSPCTSPGLRRGSENSSESNMPRRGNYRRA
KSEMSDIQQGRSGSMMDDEENLAILRRHVMNELIETERAYVEELLCVLEGYAAEMDNPLM
MHLISPALQNKKDVLFGNMEEIYHFHNRIFLRELENYIDYPELVGRCFLERMEDFQIYEK
YCQNKPRSESLWRQCSDCVFFQECQKKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSK
NCEGAEDLQEALTSILGILKAVNDSMHLIAITGYDGNLNELGKLLMQGSFSVWTDHKKGH
AKVKDLARFKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLNMTAVGITENVK
GDVKKFEIWYNAREEVYIIQAPTPEIKATWVNEIRKVLTSQLQACREASQHRALEQTQSL
PLPTSSNTSPSKNQTKNIKKLEERKTDPAGLEGYVSSASVPKNPDKSKDDTVTSSTSEGS
ALSKKRFTLQGFANLKSQKASPTSPDKKAKRHEVKSDPTPFGLRGWTKNSYSLDASEDND
GWSSTEEPLNSSDAEEEGGAGPRKLVPGKYTVVADHDEKGGPESLAVKSGDIVELLQEGE
EGFWFVKNLTTSKEGWVPASNLLALISNSKSAQSLSSSESGTGSTFLSSSSSCSESCNAT
FSDIKG
Download sequence
Identical sequences G3WY65
ENSSHAP00000020370 ENSSHAP00000020370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]