SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007172 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007172
Domain Number 1 Region: 1059-1231
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.73e-47
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.013
Further Details:      
 
Domain Number 2 Region: 441-502,568-665
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.62e-40
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.047
Further Details:      
 
Domain Number 3 Region: 915-1055
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.47e-36
Family Poly(A) polymerase, PAP, N-terminal domain 0.023
Further Details:      
 
Domain Number 4 Region: 284-473
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 9.09e-28
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.038
Further Details:      
 
Domain Number 5 Region: 1251-1279
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000471
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 
Domain Number 6 Region: 1299-1330
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000959
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007172   Gene: ENSSHAG00000006231   Transcript: ENSSHAT00000007234
Sequence length 1552
Comment pep:novel scaffold:DEVIL7.0:GL856722.1:214444:267332:1 gene:ENSSHAG00000006231 transcript:ENSSHAT00000007234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESTSSKNGNHEPRKSARVVYEESKALRAPTNQNLKPRNDRVIRDIGRSSPSGNSNKKN
KQNDVCTEKIELKSCKVNTSSVPGTKDLGSVLQDQSHGKAKKSPGPLATGEGVKPVRTQQ
VEDNAPSSSAPSSSASEKDVKKETSPTTVQRGKPALESAPGSPKLKPSTDHTSDPGHAVS
GTEDKSDDLSKLKSAEPPKDPPSELDYLENATTIDESTLTPEQKLGLKQAEERLERDYIF
RLEKRSPEYTNCRYLCKLCLVHIENIQGAHKHIKEKRHKKNITEKQEENELRALPPPSPA
QLAALSSTLMQAAKEQGISDNDFGFRQEIVTEMEKVIQQRLPDCSLRLYGSSLTRFAFKS
SDVNIDVKFPSKMSHPDVLIQVLDILKNCALYSEVESDFHAKVPVVFCKDVKSGLICKVS
AGNDVACLTTDLLAALGKLEPVLTPLVLAFRYWARLCHIDCQAEGGIPSYSFALMVMFFL
QQRKPPLLPSYLGSWIEGFDSKRVDDHQLKGIEDEKFVKWEYKPMPSGPGKNSGASENKT
KADQRSGTKKPTSSETDSQNGAAKERHGKSPLALEIPNQVSLGQLWLELLKFYTLEFALE
EYVISVRVQELLTRENKNWPKRRIAIEDPFALKRNVARSLNSQMVFEYILERFRTAYKYF
ACPQSKDGNKCKVDSRKKERGKMNSKKPAKSGDVGASGCPLQGESVEKTKPGSRCGAHTC
QSDECNEPECASPRCRKDVGRLGKKLDAADSSYDEDAREPGTANDGDELEPKSLEEQPDV
EPPEPCSKEEVSRQCRCHEHRSRDPDAVSDPEGTPLRPDLDTKCLPPASCTDTDTSATSP
HCQAPAEASDLKDEDQPCPPEMHYVFDKFILTSGKPPTIVCSICKRDGHSKNDCPDDFKK
IDLKPLPPMTYRFRDILDLVCKKCFDELSPPFSEQQSREQILASLERFIQKEYNEKARLC
LFGSSKNGFGFRDSDLDICMTLDGHENAEKLNCKEIIEGLAKILKRHPGLKNILPITTAK
VPIVKFEHRRSGLEGDISLYNTLAQHNTRMLATYAAIDPRVQYLGYTMKVFAKRCDIGDA
SRGSLSSYAYILMVLYFLQQRDPPVIPVLQEIFDGKQIPQRMVDGWNAFFFDDMEELKKR
LPSLGQNTETLGELWLGLLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFD
LNHNLGAGVSRKMTNFIMKAFINGRKLFGTPFYPLVGREAEYFFDSKVLTDGELAPNDRC
CRVCGKIGHYMKDCPKRRSALLFRLKKKENEKEDEKEMKDEDRELREKRCFICGDVGHVR
RECPEYKQARQRNNGLAGAQLVRGLVGAQAVAGSVQQQVDRPLRTRQPSECVSLSPLRVG
VGRQAAPPPHQVQLPLFNFPQSPPGQYSALHNLGLLQVHPHPHPLPLPGATWPIHGPVIH
SAPGNPASTVSLNDPSIIFAQPAARPPLGIPTSHEGHWHSPVAPNSLVNNGAVGNSDQGF
QGQFAKLTPPIPWDHGAPAHFPFLPASWPYGGVPQNFLQQGNASFQPNKAFY
Download sequence
Identical sequences G3VVG7
ENSSHAP00000007172 ENSSHAP00000007172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]